Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-LEFTY2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEFTY2 antibody: synthetic peptide directed towards the N terminal of human LEFTY2. Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK |
Rabbit Polyclonal Anti-DCN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCN antibody: synthetic peptide directed towards the N terminal of human DCN. Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
Rabbit polyclonal antibody to BMPR2 (bone morphogenetic protein receptor, type II (serine/threonine kinase))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 667 and 951 of BMPR2 (Uniprot ID#Q13873) |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit Polyclonal Anti-ID1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ID1 antibody: synthetic peptide directed towards the middle region of human ID1. Synthetic peptide located within the following region: IRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEVRSRSDH |
Rabbit anti-TTK Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TTK |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Active filters
Clonalities
- Polyclonal
Pathways
- TGF-beta signaling pathway
Filter by
Category
Target Symbol
- RPS6KB1 (39)
- MYC (25)
- SMAD1 (25)
- SMAD2 (22)
- SMAD3 (21)
- MAPK3 (15)
- ROCK2 (15)
- MAPK1 (14)
- SP1 (12)
- TNF (12)
- DCN (10)
- SMAD7 (10)
- TGFBR2 (10)
- ACVR1 (9)
- EP300 (9)
- IFNG (9)
- PPP2CA (9)
- TFDP1 (9)
- TGFB1 (9)
- SMAD4 (8)
- TGFB2 (8)
- TGFBR1 (8)
- CREBBP (7)
- CUL1 (7)
- FST (7)
- ID4 (7)
- PPP2R1A (7)
- RHOA (7)
- RPS6KB2 (7)
- BMP2 (6)
- BMP7 (6)
- BMPR2 (6)
- CDKN2B (6)
- E2F4 (6)
- INHBA (6)
- PITX2 (6)
- ROCK1 (6)
- SMAD6 (6)
- THBS1 (6)
- ACVR1B (5)
- ACVR1C (5)
- AMH (5)
- BMP5 (5)
- BMP6 (5)
- RBL2 (5)
- SKP1 (5)
- SMAD5 (5)
- TGFB3 (5)
- ACVR2A (4)
- ACVR2B (4)
- ID2 (4)
- ID3 (4)
- INHBC (4)
- LEFTY2 (4)
- NODAL (4)
- PPP2R1B (4)
- SMAD9 (4)
- SMURF1 (4)
- TTK (4)
- ACVRL1 (3)
- AMHR2 (3)
- BMP4 (3)
- BMP8A (3)
- BMP8B (3)
- COMP (3)
- E2F5 (3)
- NOG (3)
- SMURF2 (3)
- BMPR1A (2)
- BMPR1B (2)
- GDF5 (2)
- GDF6 (2)
- GDF7 (2)
- ID1 (2)
- INHBB (2)
- PPP2CB (2)
- RBL1 (2)
- RBX1 (2)
- CHRD (1)
- INHBE (1)
- LEFTY1 (1)
- LTBP1 (1)
- THBS2 (1)
Reactivities
Applications
Antibody Hosts
Conjugates
Modifications
Families
- Druggable Genome (533)
- Transcription Factors (239)
- ES Cell Differentiation/IPS (181)
- Protein Kinase (161)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (138)
- Secreted Protein (132)
- Cancer stem cells (115)
- Stem cell relevant signaling - JAK/STAT signaling pathway (110)
- Embryonic stem cells (104)
- Transmembrane (92)
- Induced pluripotent stem cells (57)
- Stem cell - Pluripotency (37)
- Adult stem cells (35)
- Stem cell relevant signaling - Wnt Signaling pathway (25)
- Phosphatase (22)