Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Calca rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Transferrin (TF) (N-term) mouse monoclonal antibody, clone HTF-14, Purified
Applications | ELISA, FN, IF, IHC, IP, R, WB |
Reactivities | Human, Porcine, Rabbit |
Conjugation | Unconjugated |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Mouse Monoclonal RPE65 Antibody (401.8B11.3D9)
Applications | IHC |
Reactivities | Bovine, Human, Mouse, Porcine |
Conjugation | Unconjugated |
RPE65 mouse monoclonal antibody, clone 401.8B11.3D9
Applications | IF, IHC, IP, WB |
Reactivities | Bovine, Human, Mouse, Porcine |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
USD 440.00
2 Weeks
Langerin (CD207) mouse monoclonal antibody, clone 310F7.02/HD26
Applications | ELISA, FC, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)
Applications | IHC, IP, WB |
Reactivities | Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep |
Conjugation | Unconjugated |
Chicken Polyclonal 200kDa Neurofilament Heavy Antibody
Applications | IF, WB |
Reactivities | Bovine, Feline, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Neurofilament Heavy protein purified from bovine spinal cord |
Rabbit Polyclonal Antibody against ATG5
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Alpha-2-Macroglobulin, (α2M), mouse anti swine, clone PSA24
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
Lipocalin 2 (Gelatinase-Associated Lipocalin, NGAL), mouse anti porcine, clone PNL110
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
Mouse Monoclonal RBFOX3/NeuN Antibody (1B7)
Applications | IF, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
USD 580.00
2 Weeks
Reticular Fibroblasts and Reticular Fibres (connective tissue), mouse anti porcine, clone PRF414
Applications | ELISA, IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Mouse Monoclonal anti-KDELR1 Antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Rat, Mouse, Hamster, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Drosophilia, Xenopus |
Conjugation | Unconjugated |
Rabbit Polyclonal AGPAT6 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Porcine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human AGPAT6 protein sequence (between residues 400-456). [Swiss-Prot Q86UL3] |
Alpha-2-Macroglobulin, (α2M), mouse anti swine, clone PAP-F101
Applications | IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Pancreatic alpha amylase (AMY2A) sheep polyclonal antibody, Ig Fraction
Applications | ELISA, WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | Porcine pancreatic Alpha-Amylase |
USD 440.00
2 Weeks
Mannose Receptor (MRC1) (Extracell. Dom.) mouse monoclonal antibody, clone 122D2.08
Applications | FC, FN, IHC, IP, NEUT, WB |
Reactivities | Human, Porcine, Sheep |
Conjugation | Unconjugated |
Bronchial Basement Cells, mouse anti porcine, clone PLB42
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against SAT1
Applications | WB |
Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
Applications | FC, IHC, WB |
Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
Conjugation | Unconjugated |
Hemoglobin beta (Beta-globin), mouse anti porcine, clone PLA114
Applications | ELISA, IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Niemann-Pick C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Rabbit Polyclonal Ki-67/MKI67 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
HGF (hepatocyte growth factor, scatter factor, SF) mouse anti porcine, clone PG1
Applications | IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal DUOX2 Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8] |
Albumin porcine, mouse anti porcine, clone PAL17
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against PTGDS
Applications | WB |
Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
Conjugation | Unconjugated |
Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
Rabbit Polyclonal Aquaporin-2 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080] |
Rabbit Polyclonal SREBP1 Antibody
Applications | WB |
Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Mouse Monoclonal Beclin 1/ATG6 Antibody (9B6)
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Equine, Porcin |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Transferrin (TF) (N-term) mouse monoclonal antibody, clone HTF-14, Aff - Purified
Applications | ELISA, FN, IF, WB |
Reactivities | Human, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
USD 440.00
2 Weeks
Langerin (CD207) mouse monoclonal antibody, clone 306G9.01/HD24
Applications | FC, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against ADFP
Applications | IHC, WB |
Reactivities | Bovine, Human, Monkey, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human protein, within residues 150-250. [Swiss-Prot# Q99541] |
Rabbit Polyclonal Antibody against VPS34
Applications | WB |
Reactivities | Human, Rat, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 700-850). [Swiss-Prot# Q8NEB9] |
Rabbit Polyclonal Antibody against VEGFA
Applications | WB |
Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Cow |
Conjugation | Unconjugated |
Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal anti-CALR Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
Conjugation | Unconjugated |
Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
USD 424.00
In Stock
Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
Applications | WB |
Reactivities | Bovine, Canine, Human, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Pyruvate Carboxylase Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Rabbit Polyclonal Perilipin Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Mouse Monoclonal VEGF Antibody (VG76e)
Applications | IHC, WB |
Reactivities | Human, Bovine, Porcine, Sheep |
Conjugation | Unconjugated |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human LC3 protein (within residues 50-120). [Swiss-Prot Q9H492] |
Atrial Natriuretic Factor (1-28) (hu, bo, po); neat antiserum
Applications | ELISA |
Reactivities | Human, Bovine, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met- Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Disulfide bond) coupled to carrier protein. |