Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Mouse Monoclonal TFRC (CD71) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TSG101 Antibody is: synthetic peptide directed towards the N-terminal region of Human TSG101. Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal Anti-RAB11B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB11B antibody: synthetic peptide directed towards the C terminal of human RAB11B. Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
USD 410.00
2 Weeks
Mouse Monoclonal anti-SH3GL1 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
USD 515.00
In Stock
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal FGFR4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4. |
CBLB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CBLB |
Rabbit Polyclonal Anti-RAB22A Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Murine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
CXCR4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
Active filters
Families
- Druggable Genome
Pathways
- Endocytosis
Filter by
Target Symbol
- EGFR (207)
- MDM2 (121)
- KIT (93)
- ERBB3 (73)
- FGFR2 (66)
- MET (64)
- PDGFRA (63)
- LDLRAP1 (61)
- RET (61)
- KDR (53)
- HRAS (47)
- AP2M1 (45)
- EGF (38)
- ERBB4 (33)
- SRC (30)
- IGF1R (29)
- IL2RA (29)
- NEDD4 (29)
- IL2RB (28)
- LDLR (25)
- FLT1 (24)
- ARRB1 (23)
- CSF1R (23)
- CXCR4 (23)
- PIKFYVE (23)
- TGFBR2 (20)
- NTRK1 (18)
- RAB5A (18)
- SMURF2 (18)
- TFRC (18)
- FGFR3 (17)
- HGS (17)
- CBLC (16)
- GRK1 (15)
- F2R (14)
- GRK4 (14)
- SH3GL1 (13)
- ADRB2 (12)
- CCR5 (11)
- DNM1 (11)
- GRK2 (10)
- TRAF6 (10)
- CBL (9)
- CXCR2 (9)
- GRK5 (9)
- BMP2 (8)
- PRKCZ (8)
- RAB11A (8)
- TGFBR1 (8)
- PDCD6IP (7)
- ADRB3 (6)
- AP2B1 (6)
- GRK3 (6)
- PARD6A (6)
- RAB5C (6)
- ACVR1B (5)
- ACVR1C (5)
- ADRB1 (5)
- CDC42 (5)
- CXCR1 (5)
- EPS15 (5)
- FGFR4 (5)
- ITCH (5)
- SMURF1 (5)
- STAMBP (5)
- TSG101 (5)
- ARRB2 (4)
- IL2RG (4)
- PLD2 (4)
- RAB22A (4)
- RAB31 (4)
- GRK6 (3)
- RAB11FIP1 (3)
- RAB4A (3)
- SH3KBP1 (3)
- EHD1 (2)
- GIT1 (2)
- GIT2 (2)
- GRK7 (2)
- NEDD4L (2)
- PIP5K1A (2)
- PIP5K1B (2)
- PIP5K1C (2)
- RAB11B (2)
- RAB5B (2)
- USP8 (2)
- CBLB (1)
- CHMP1B (1)
- DAB2 (1)
- DNAJC6 (1)
- PIP4K2B (1)
- PRKCI (1)
Reactivities
- Human (1551)
- Mouse (983)
- Rat (969)
- Dog (61)
- Monkey (52)
- Canine (14)
- Bovine (12)
- Cow (9)
- Pig (5)
- Chicken (3)
- Horse (3)
- Primate (3)
- Frog (2)
- Hamster (2)
- Zebrafish (2)
- Bat (1)
- Chimpanzee (1)
- Equine (1)
- Feline (1)
- Gorilla (1)
- Macaque (1)
- Murine (1)
- Rabbit (1)
- Rhesus Monkey (1)
- Sheep (1)
- X. tropicalis (1)
- Xenopus (1)