Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Chicken Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH. The immunogen is located within amino acids 230 - 280 of GAPDH. |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
CD38 mouse monoclonal antibody, clone T16, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Antibody against ALDH1A1 (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH1A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 302-331 amino acids from the Central region of human ALDH1A1. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Mouse Monoclonal Anti-GAPDH [12D3H9] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CD38 mouse monoclonal antibody, clone T16, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
GAPDH rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mammalian, Mouse, Rat |
| Immunogen | Purified recombinant human GAPDH |
Rabbit polyclonal GAPDH Antibody (C-term R248)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 233-259 amino acids from the C-terminal region of human GAPDH. |
Rabbit Polyclonal Anti-GAPDH Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAPDH Antibody: A synthesized peptide derived from human GAPDH. |
GAPDH mouse monoclonal antibody, clone 4G5
| Applications | ELISA, IF, WB |
| Reactivities | Bovine, Feline, Goat, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
GAPDH mouse monoclonal antibody, clone H8, Purified
| Applications | ELISA, WB |
| Reactivities | Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
CD38 mouse monoclonal antibody, clone T16, APC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | APC |
Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4. |
GAPDH rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mammalian, Mouse, Rat |
| Immunogen | Purified recombinant human GAPDH |
Rabbit polyclonal GAPDH Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-91 amino acids from the N-terminal region of human GAPDH. |
Rabbit Polyclonal GAPDH antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GAPDH |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residues 150 and 200 of human GAPDH using the numbering given in entry NP_002037.2 (GeneID 2597). |
Rabbit Polyclonal TAT Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- ES Cell Differentiation/IPS
Pathways
- Metabolic pathways
Filter by
Target Symbol
Reactivities
- Human (180)
- Rat (96)
- Mouse (84)
- Monkey (13)
- Dog (10)
- Chicken (8)
- Rabbit (7)
- Bovine (6)
- Canine (4)
- Pig (4)
- Porcine (4)
- Cow (3)
- Drosophila (3)
- Feline (3)
- Xenopus (3)
- Yeast (3)
- Zebrafish (3)
- Avian (2)
- Bacteria (2)
- Insect (2)
- Primate (2)
- All Species (1)
- Goat (1)
- Guinea Pig (1)
- Hamster (1)
- Invertebrate (1)
- Protozoa (1)