Germany
Japan
United Kingdom
China
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
Primary Antibodies
View as table DownloadCDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
CD61 (ITGB3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 741-790 of Human Integrin β3. |
Integrin alpha 1 (ITGA1) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 727-755 amino acids from the Central region of human ITGA1. |
Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6. |
USD 390.00
2 Weeks
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal ITGA6 (light chain, Cleaved-Glu942) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGA6. |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGA5 (heavy chain, Cleaved-Phe42) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGA5. |
Rabbit polyclonal Integrin beta1 (Ab-789) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Rabbit polyclonal anti-ADCY5/ADCY6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306). |
Rabbit polyclonal anti-ADRB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB1 . |
Rabbit polyclonal ITGA7 (light chain, Cleaved-Glu959) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Integrin alpha-7 light chain. |
Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGAV. |
Rabbit polyclonal anti-RyR2 (Ser2808) antibody (Phospho-specific)
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific phosphopeptide. The antibody against non-phosphopeptide was removed by chromatography using non-phosphopeptide corresponding to the phosphorylation site. |
| Modifications | Phospho-specific |
ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%). |
USD 160.00
In Stock
Rat Anti-Human/Mouse CD49f (Integrin alpha 6) Purified (50 ug)
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Mouse Anti-Human CD61 (Integrin beta 3) Purified (100 ug)
| Applications | FC |
| Reactivities | Baboon, Canine, Human, Rhesus |
| Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit Polyclonal Integrin alpha4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin alpha4 |
Rabbit Polyclonal Integrin beta3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
| Modifications | Phospho-specific |
Mouse Monoclonal ITGB3 (CD61) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Anti-human CaV1.2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human Cav1.2 (exon 1B). Intracellular, N-terminus. |
Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
Rabbit Polyclonal Integrin alpha V Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD41 (ITGA2B) mouse monoclonal antibody, clone 96.2C1, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
| Applications | ELISA, FN |
| Reactivities | Human |
Integrin beta 1 (ITGB1) mouse monoclonal antibody, clone B-D15, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
Integrin beta 1 (ITGB1) mouse monoclonal antibody, clone B-D15, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
Integrin beta 1 (ITGB1) mouse monoclonal antibody, clone B-D15, Purified
| Applications | FC, IHC |
| Reactivities | Human |
USD 340.00
2 Weeks
delta Sarcoglycan (SGCD) mouse monoclonal antibody, clone AT19G8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
USD 230.00
2 Weeks
delta Sarcoglycan (SGCD) mouse monoclonal antibody, clone AT19G8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Integrin beta 5 (ITGB5) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 720-770 of Human Integrin β5. |
Active filters
Families
- Transmembrane
Pathways
- Dilated cardiomyopathy
Filter by
Category
Target Symbol
- TNF (60)
- ITGB3 (35)
- ITGB1 (27)
- ITGA6 (13)
- ITGAV (13)
- ITGA4 (11)
- ITGA2 (9)
- ITGA5 (9)
- SGCD (9)
- ATP2A2 (8)
- TGFB2 (8)
- ITGA3 (7)
- CACNA1C (6)
- ITGB5 (6)
- ITGB6 (6)
- ADRB1 (5)
- EMD (5)
- TGFB3 (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- CACNG1 (4)
- ITGA2B (4)
- PLN (4)
- ADCY2 (3)
- ADCY6 (3)
- CACNG4 (3)
- CACNG5 (3)
- CACNG6 (3)
- ITGA7 (3)
- ITGB7 (3)
- SGCB (3)
- ADCY3 (2)
- ADCY8 (2)
- CACNA1D (2)
- DAG1 (2)
- ITGA1 (2)
- ITGA8 (2)
- RYR2 (2)
- SGCA (2)
- SGCG (2)
- ADCY7 (1)
- ADCY9 (1)
- CACNA1S (1)
- CACNG3 (1)
- CACNG7 (1)
- CACNG8 (1)
- ITGA11 (1)
- ITGB8 (1)
- SLC8A1 (1)