Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734)

Rabbit Polyclonal TACE Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid.

DLL4 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Immunogen Synthetic peptide corresponding to the internal region of human DLL4.

Rabbit Polyclonal Anti-JAG1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen JAG1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human JAG1.

NOTCH2 (2457-2471) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from human NOTCH2 (aa 2457-2471)

DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3.

Rabbit Polyclonal DLL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody.

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.

ADAM17 mouse monoclonal antibody, clone 1F6

Applications ELISA, IF, IHC, PLA, WB
Reactivities Human

Rabbit polyclonal anti-Jagged 1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-125 of human Jagged-1protein.

PEN2 (PSENEN) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PSENEN antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal APH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APH1 antibody was raised against a 18 amino acid peptide from near the center of human APH1.

Rabbit Polyclonal Anti-Notch 2 (Cleaved-Asp1733) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Notch 2 (Cleaved-Asp1733) Antibody: A synthesized peptide derived from human Notch 2 (Cleaved-Asp1733)

DLL4 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure HEK293 cells derived Recombinant Human sDLL-4 (Cat.-No AR31113PU-N).

Lunatic Fringe (LFNG) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 93~122 amino acids from the Central region of human LFNG

Rabbit monoclonal antibody against Jagged2(clone EPR3646)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal Notch 2 (Cleaved-Asp1733) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 2.

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.

Rabbit polyclonal anti-DELTA-4 antibody

Applications IHC, WB
Reactivities Human, partial reactivity to Mouse and Rat
Conjugation Unconjugated
Immunogen Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4.

Rabbit Polyclonal Anti-Presenilin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1

Rabbit Polyclonal PEN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2.

Rabbit Polyclonal Nicastrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nicastrin antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human Nicastrin.

Rabbit Polyclonal Nicastrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nicastrin antibody was raised against a 18 amino acid peptide from near the center of human Nicastrin.

Rabbit polyclonal NOTCH2 (Cleaved-Ala1734) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NOTCH2.

Rabbit polyclonal anti-NOTCH 2 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human, Dog
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2396-2409 of human Notch 2 (the total protein is 2471 aa). A residue of cysteine was added to the amino terminal end to facilitate coupling.

Rabbit Polyclonal ADAM 17 (Thr735) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ADAM 17 around the phosphorylation site of Threonine 735
Modifications Phospho-specific

Rabbit polyclonal ADAM 17 (Cleaved-Arg215) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ADAM 17.

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL

DLL4 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure HEK293 cells derived Recombinant Human sDLL-4 (Cat.-No AR31113PU-N).

DLL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure recombinant Human sDLL-4.

DLL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure recombinant Human sDLL-4.

Jagged1 (JAG1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1129-1158 amino acids from the C-terminal region of Human CD339 / JAG1

Goat Polyclonal Antibody against APH1A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVTDRSDARLQYG, from the internal region of the protein sequence according to NP_001071096.1; NP_057106.2.

Rabbit Polyclonal PEN2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2.

Rabbit polyclonal anti-LFNG antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human LFNG.

Rabbit polyclonal anti-NOTCH 2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 2 located near the N-terminal sequence of the cleaved N intracellular domain (NICD).

Goat Anti-JAG1 Antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TNKQDNRDLESAQS, from the C Terminus of the protein sequence according to NP_000205.1.

Biotinylated Anti-Human sDLL-4 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen HEK293 cells derived Recombinant Human sDLL-4

Anti-Human sDLL-4 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen HEK293 cells derived Recombinant Human sDLL-4

Rabbit Polyclonal Anti-PSEN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN2 antibody: synthetic peptide directed towards the N terminal of human PSEN2. Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV

Rabbit Polyclonal Anti-DLL1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC

RFNG (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 281-310 amino acids from the C-terminal region of Human RFNG.

Goat Polyclonal Antibody against ADAM17

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence LQRQNRVDSKETEC, from the C Terminus of the protein sequence according to NP_003174.3.

Goat Anti-DLL1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3.

Rabbit Polyclonal APH1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APH1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human APH1a.

Rabbit polyclonal NOTCH2 (Cleaved-Val1697) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NOTCH2.

Rabbit polyclonal anti-TCR alpha antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 138 of human TCRa

Goat Anti-DLL4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence KNTNQKKELEVDC, from the internal region of the protein sequence according to NP_061947.1.

NCSTN Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NCSTN