Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit anti-PARP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PARP1 |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal Anti-TLE4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLE4 antibody: synthetic peptide directed towards the N terminal of human TLE4. Synthetic peptide located within the following region: GAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS |
Rabbit Polyclonal Anti-UHRF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the N terminal of human UHRF2. Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART |
Caldesmon (CALD1) rabbit monoclonal antibody, clone EP19, Supernatant
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal IRF7 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HOXA10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA10 antibody: synthetic peptide directed towards the N terminal of human HOXA10. Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP |
Anti-SOX2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2 |
Anti-SMAD7 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 370-383 amino acids of Human SMAD family member 7 |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Transcription Factors
Citations
- Yes
Filter by
Category
Target Symbol
- CTNNB1 (2)
- HIF1A (2)
- MITF (2)
- NFKB1 (2)
- POU5F1 (2)
- RELA (2)
- ZEB2 (2)
- ATRX (1)
- BCL6 (1)
- BRCA1 (1)
- CCNE1 (1)
- DNMT1 (1)
- EZH1 (1)
- FOXO1 (1)
- FOXO3 (1)
- FOXP3 (1)
- GLI1 (1)
- HOXA10 (1)
- HOXC8 (1)
- IRF3 (1)
- IRF7 (1)
- KCNH2 (1)
- LDB1 (1)
- MYB (1)
- MYCN (1)
- MZF1 (1)
- NR3C1 (1)
- NR4A1 (1)
- PARP1 (1)
- POFUT1 (1)
- PPARGC1A (1)
- REL (1)
- RNF2 (1)
- RUNX2 (1)
- RUNX3 (1)
- SIAH2 (1)
- SMAD7 (1)
- SOD2 (1)
- SOX2 (1)
- SPDEF (1)
- STAT1 (1)
- STAT3 (1)
- TFAM (1)
- TLE4 (1)
- TNF (1)
- UHRF2 (1)
- ZEB1 (1)
- ZKSCAN3 (1)
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (15)
- Prostate cancer (8)
- Toll-like receptor signaling pathway (8)
- Adipocytokine signaling pathway (7)
- Chemokine signaling pathway (7)
- RIG-I-like receptor signaling pathway (7)
- Cytosolic DNA-sensing pathway (6)
- MAPK signaling pathway (6)
- Pancreatic cancer (6)
- Acute myeloid leukemia (5)
- Apoptosis (5)
- NOD-like receptor signaling pathway (5)
- Neurotrophin signaling pathway (5)
- Small cell lung cancer (5)
- T cell receptor signaling pathway (5)
- B cell receptor signaling pathway (4)
- Chronic myeloid leukemia (4)
- Epithelial cell signaling in Helicobacter pylori infection (4)
- Melanogenesis (4)
- Basal cell carcinoma (3)
- Endometrial cancer (3)
- Huntington's disease (3)
- Metabolic pathways (3)
- Adherens junction (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Colorectal cancer (2)
- Focal adhesion (2)
- Insulin signaling pathway (2)
- Jak-STAT signaling pathway (2)
- Leukocyte transendothelial migration (2)
- Melanoma (2)
- Pathogenic Escherichia coli infection (2)
- Renal cell carcinoma (2)
- TGF-beta signaling pathway (2)
- Thyroid cancer (2)
- Tight junction (2)
- Wnt signaling pathway (2)
- mTOR signaling pathway (2)
- Allograft rejection (1)
- Alzheimer's disease (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Asthma (1)
- Base excision repair (1)
- Cell cycle (1)
- Cysteine and methionine metabolism (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Fc epsilon RI signaling pathway (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Hematopoietic cell lineage (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Non-small cell lung cancer (1)
- Oocyte meiosis (1)
- Systemic lupus erythematosus (1)
- Type I diabetes mellitus (1)
- Type II diabetes mellitus (1)
- Ubiquitin mediated proteolysis (1)
- p53 signaling pathway (1)