Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC |
| Reactivities | Fish |
| Immunogen | Collagen Type I extracted and purified from salmon fish skin. |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Salmon, Sole, Tuna |
| Immunogen | Purified Collagen type I from Salmon skin |
Rabbit Polyclonal antibody to Collagen III alpha1 (collagen, type III, alpha 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1247 and 1389 of Collagen III alpha1 |
Rabbit Polyclonal Fibronectin/Anastellin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made toward the C-terminal region of the human Fibronectin protein (within residues 2250-2300). [Swiss-Prot P02751] |
Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Porcine |
| Immunogen | Porcine Collagen, types 1 and 3 from skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Collagen Type I from Human and Bovine Placenta |
USD 425.00
5 Days
Collagen I (COL1A1) (+ type II, III, IV, and V) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | A mixture of human collagen 1-5 from human placenta. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Fish, Goldfish |
| Immunogen | Purified collagen type I from goldfish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Salmon, Sole, Tuna |
| Immunogen | Purified Collagen type I from Salmon skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Chicken |
| Immunogen | Purified collagen type IV from chicken skin |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified collagen type V from Human placenta |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- ECM-receptor interaction
Filter by
Category
Target Symbol
- COL1A1 (20)
- COL5A1 (8)
- ITGA6 (7)
- SPP1 (6)
- ITGB3 (5)
- CD44 (4)
- ITGA4 (4)
- ITGB1 (4)
- COL1A2 (3)
- COL3A1 (3)
- FN1 (3)
- HMMR (3)
- ITGA2 (3)
- ITGB4 (3)
- LAMA1 (3)
- LAMA4 (3)
- LAMB3 (3)
- THBS1 (3)
- TNXB (3)
- VTN (3)
- CD36 (2)
- CD47 (2)
- COL5A2 (2)
- ITGA2B (2)
- ITGA3 (2)
- ITGA7 (2)
- ITGAV (2)
- LAMA3 (2)
- LAMA5 (2)
- LAMB1 (2)
- SDC1 (2)
- TNC (2)
- TNN (2)
- TNR (2)
- VWF (2)
- COL11A2 (1)
- COL4A4 (1)
- COL6A3 (1)
- COMP (1)
- GP1BA (1)
- GP1BB (1)
- GP6 (1)
- GP9 (1)
- HSPG2 (1)
- IBSP (1)
- ITGA1 (1)
- ITGA11 (1)
- ITGA5 (1)
- ITGA8 (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- LAMC1 (1)
- SDC4 (1)
- THBS2 (1)