Antibodies

View as table Download

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Human, Macaque, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Rabbit Polyclonal Anti-SPIB Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB.

Anti-POU5F1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1

Rabbit anti-BDNF Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BDNF

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

Rabbit monoclonal antibody against HNF 3 Beta(clone EPR4466)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker

Applications FC, IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431]

Rabbit polyclonal KLF5 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5.

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Rabbit Polyclonal Anti-SOX7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the middle region of human SOX7. Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS

Rabbit polyclonal SOX4 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 86-114 amino acids from the N-terminal region of human SOX4.

Rabbit Polyclonal Anti-OTX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

Rabbit polyclonal KLF4 Antibody (N-term C74)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4.

Rabbit Polyclonal Anti-SOX4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX4 Antibody: synthetic peptide directed towards the N terminal of human SOX4. Synthetic peptide located within the following region: MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPS

Rabbit Polyclonal KLF4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLF4 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human KLF4.

Rabbit Polyclonal TCF3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TCF3 antibody was raised against a 17 amino acid peptide near the amino terminus of human TCF3.

Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K).
Modifications Phospho-specific

Rabbit Polyclonal AXIN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2.

Anti-GDF3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 251-364 amino acids of human growth differentiation factor 3

Rabbit polyclonal CD38 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38.

SOX2 (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal NANOG Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NANOG antibody was raised against a 19 amino acid peptide near the center of human NANOG.

Rabbit polyclonal anti-TCF3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TCF3.

Rabbit polyclonal SOX4 Antibody (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human SOX4.

Rabbit polyclonal OCT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human OCT3 antibody.

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7

Rabbit polyclonal Transcription Factor 3 / E2A (Thr355) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human E2A around the phosphorylation site of threonine 355 (P-S-TP-P-V).
Modifications Phospho-specific

AXIN2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen AXIN2 / Axin 2 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human AXIN2

Rabbit polyclonal FOXA2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2.

Rabbit polyclonal FOXA2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2.

Rabbit polyclonal KLF4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This KLF4 antibody is generated from rabbits immunized with a his tag recombinant protein of human KLF4.

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

Anti-Human GDF-3 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GDF-3

Rabbit anti-SOX2 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOX2

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT

Rabbit Polyclonal KLF4 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 1-50 of human KLF4 was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SOX10 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human SOX10.

Rabbit Polyclonal POU5F1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen POU5F1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human POU5F1.

Rabbit polyclonal FGF4 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4.

Rabbit Polyclonal anti-UTF1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UTF1 antibody: synthetic peptide directed towards the middle region of human UTF1. Synthetic peptide located within the following region: AREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Rabbit anti SOX-2 Polyclonal Antibody

Applications IHC, WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide derived from N-terminus of Human SOX-2 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog.

Rabbit polyclonal anti-Transcription Factor 3 (E2A Immunoglobulin Enhancer Binding Factors E12/E47) antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human E2A.

WNT8A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Horse, Human, Monkey
Conjugation Unconjugated
Immunogen WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%).

Anti-Human BDNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BDNF

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2

Anti-Human FGF-4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-4