Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Antibody against MAP3K5 (S83)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASK1(MEKK5/MAP3K5) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from human ASK1(MEKK5/MAP3K5). |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Pathways
- MAPK signaling pathway
Filter by
Category
Target Symbol
- AKT1 (29)
- EGFR (22)
- RELA (22)
- TP53 (22)
- PAK1 (19)
- CASP3 (14)
- MAP2K1 (13)
- MAPK14 (13)
- CHUK (12)
- EGF (11)
- JUN (11)
- PDGFRB (11)
- ATF2 (10)
- BRAF (10)
- MAP3K5 (10)
- RAF1 (10)
- FOS (8)
- IKBKG (8)
- MAPK8 (8)
- MYC (8)
- NFKB1 (8)
- PRKCA (8)
- AKT2 (7)
- BDNF (7)
- JUND (7)
- MAP2K4 (7)
- NR4A1 (7)
- RPS6KA1 (7)
- TNF (7)
- FGFR1 (6)
- FGFR2 (6)
- FGFR3 (6)
- MAP2K6 (6)
- MAP3K8 (6)
- MAPKAPK2 (6)
- NTRK2 (6)
- PDGFA (6)
- PDGFB (6)
- TNFRSF1A (6)
- ARRB1 (5)
- DUSP1 (5)
- ELK1 (5)
- FASLG (5)
- FGF2 (5)
- MAPT (5)
- NGF (5)
- NTRK1 (5)
- PAK2 (5)
- TRAF2 (5)
- TRAF6 (5)
- AKT3 (4)
- CRK (4)
- CRKL (4)
- FGF1 (4)
- FGF4 (4)
- FGF7 (4)
- GRB2 (4)
- IKBKB (4)
- MAP2K2 (4)
- MAP3K14 (4)
- MAP3K4 (4)
- MAP3K7 (4)
- MAPK1 (4)
- NFATC4 (4)
- RPS6KA5 (4)
- SRF (4)
- TAOK1 (4)
- TGFB1 (4)
- TGFB3 (4)
- TGFBR2 (4)
- ACVR1B (3)
- ACVR1C (3)
- CACNA1C (3)
- CD14 (3)
- CDC25B (3)
- DUSP6 (3)
- FAS (3)
- IL1B (3)
- IL1R1 (3)
- MAPK3 (3)
- NRAS (3)
- NTF3 (3)
- PDGFRA (3)
- PPP3CA (3)
- RPS6KA6 (3)
- TGFBR1 (3)
- ARRB2 (2)
- CACNB1 (2)
- DAXX (2)
- DDIT3 (2)
- DUSP8 (2)
- GADD45A (2)
- GADD45B (2)
- HRAS (2)
- IL1A (2)
- IL1R2 (2)
- LAMTOR3 (2)
- MAP2K3 (2)
- MAP3K11 (2)
- MAP3K12 (2)