Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Rabbit Polyclonal Anti-OAT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI |
Rabbit Polyclonal Anti-ASS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE |
Rabbit Polyclonal Anti-ASS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF |
Rabbit Polyclonal Anti-CKMT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CKMT2 antibody: synthetic peptide directed towards the N terminal of human CKMT2. Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA |
Rabbit Polyclonal Anti-PRODH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRODH2 antibody: synthetic peptide directed towards the C terminal of human PRODH2. Synthetic peptide located within the following region: LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR |
Rabbit Polyclonal Anti-ABP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801) |
Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424) |
Rabbit polyclonal GLS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
Rabbit polyclonal OAT Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This OAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-55 amino acids from the N-terminal region of human OAT. |
ALDH2 (N-term) rabbit polyclonal antibody, Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277) |
Rabbit Polyclonal antibody to Creatine kinase 1B (creatine kinase, mitochondrial 1B)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 63 and 287 of Creatine kinase MT 1B (Uniprot ID#P12532) |
Rabbit polyclonal OTC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This OTC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the Central region of human OTC. |
Rabbit Polyclonal Anti-GLS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF |
Rabbit Polyclonal Anti-ARG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Arginine and proline metabolism
Filter by
Category
Target Symbol
- ALDH4A1 (5)
- AMD1 (5)
- NOS2 (5)
- ARG1 (4)
- ASS1 (4)
- ACY1 (3)
- ALDH2 (3)
- ALDH3A2 (3)
- ASL (3)
- CKM (3)
- CKMT2 (3)
- CPS1 (3)
- GLS2 (3)
- GLUD1 (3)
- GLUL (3)
- GOT1 (3)
- NOS3 (3)
- ALDH9A1 (2)
- AOC1 (2)
- CKMT1B (2)
- GLS (2)
- GOT2 (2)
- MAOA (2)
- MAOB (2)
- OAT (2)
- OTC (2)
- CKB (1)
- GATM (1)
- NOS1 (1)
- ODC1 (1)
- PRODH2 (1)
- PYCR1 (1)
- PYCR2 (1)