Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit polyclonal antibody to UBE2G2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 165 of UBE2G2 (Uniprot ID#P60604) |
Rabbit anti-TTK Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TTK |
Rabbit Polyclonal XIAP (Ser87) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human XIAP around the phosphorylation site of Serine 87 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SOCS1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human SOCS1. |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
Rabbit Polyclonal Anti-TRI18 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRI18 Antibody: A synthesized peptide derived from human TRI18 |
Rabbit polyclonal anti-CDC20 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC20. |
Rabbit polyclonal anti-H-NUC antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human H-NUC. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 |
Rabbit Polyclonal CBL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL |
Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674 |
| Modifications | Phospho-specific |
Rabbit Polyclonal XIAP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human XIAP |
Rabbit anti-VHL Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VHL |
Rabbit Polyclonal antibody to UBE2B (ubiquitin-conjugating enzyme E2B (RAD6 homolog))
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 152 of UBE2B |
Rabbit Polyclonal ITCH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ITCH antibody was raised against a 15 amino acid peptide near the amino terminus of human ITCH |
Rabbit polyclonal antibody to CUL-3 (cullin 3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 352 and 656 of Cullin 3 (Uniprot ID#Q13618) |
Rabbit polyclonal anti-APC6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APC6. |
Rabbit polyclonal APC1 phospho S355 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 351-359 of Human Apc1 protein. |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Druggable Genome
Pathways
- Ubiquitin mediated proteolysis
Filter by
Target Symbol
- SOCS1 (8)
- CBL (5)
- DDB1 (4)
- TRAF6 (4)
- XIAP (4)
- BIRC2 (3)
- CDC20 (3)
- CDC27 (3)
- CUL3 (3)
- SOCS3 (3)
- AIRE (2)
- ANAPC5 (2)
- BRCA1 (2)
- MID1 (2)
- PIAS1 (2)
- SIAH1 (2)
- SKP1 (2)
- VHL (2)
- ANAPC1 (1)
- ANAPC10 (1)
- ANAPC11 (1)
- ANAPC4 (1)
- ANAPC7 (1)
- BTRC (1)
- CDC16 (1)
- CDC23 (1)
- CUL1 (1)
- CUL2 (1)
- DDB2 (1)
- ELOC (1)
- FBXO2 (1)
- HUWE1 (1)
- ITCH (1)
- MAP3K1 (1)
- MDM2 (1)
- PML (1)
- SMURF1 (1)
- SMURF2 (1)
- STUB1 (1)
- SYVN1 (1)
- TTK (1)
- UBE2B (1)
- UBE2C (1)
- UBE2G2 (1)
- UBE2K (1)
- UBE2N (1)
- UBE2S (1)