Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
USD 360.00
2 Weeks
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal beta-Arrestin 2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal beta Tubulin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a portion of amino acids 400-450 of human b-tubulin was used as immunogen for this antibody, GenBank no. gi|27227551|gb|AAN85571.1|. |
Rabbit Polyclonal HDAC9 Antibody
| Applications | WB |
| Reactivities | Human, Bovine, Canine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 100-150 of human HDAC-9 was used as the immunogen. |
Rabbit Polyclonal HDAC9 [p Ser155] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing phospho-serine 155 of human HDAC-7 was used as the immunogen. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-TNFRSF9 Antibody
| Applications | WB |
| Reactivities | Canine, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142] |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | IF |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142] |
Rabbit polyclonal Hsp60 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human Hsp60 produced through recombinant DNA methods in E.coli |
Rabbit polyclonal SOD (Mn) Antibody
| Applications | IHC |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Gerbil, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig |
| Conjugation | Unconjugated |
| Immunogen | Human Mn SOD |
Rabbit polyclonal GRP78 (Bip) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine. Other species not yet tested |
| Conjugation | Unconjugated |
| Immunogen | Full length human GRP78 (Bip) his tagged at the N terminus |
Rabbit Polyclonal Anti-Calcineurin A Antibody
| Reactivities | Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human Calcineurin A peptide (AA 364-283) |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Rabbit Polyclonal 5-HT7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1). |
Rabbit Polyclonal VDAC2/3 Antibody
| Applications | WB |
| Reactivities | Human, Bovine, Canine, Feline, Primate |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 120-132 (KKSGKIKSSYKRE) of human VDAC2 protein were used as the immunogen. |
USD 424.00
5 Days
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Canine, Feline, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 30-70). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Kv1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family. |
Rabbit Polyclonal Potassium Channel Kv3.1 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122] |
Rabbit Polyclonal STAT3 [p Tyr705] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Canine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of human STAT3 protein containing a phosphorylated tyrosine residue at position 705 was used as the immunogen for this phospho antibody. |
Rabbit Polyclonal MEK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen. |
Rabbit Polyclonal MTSS1 Antibody
| Applications | WB |
| Reactivities | Canine, Chicken, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acid 150-200 of human MTSS1 protein was used as the immunogen. |
Active filters
Category
- Antibodies
Reactivities
- Canine
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- KCNA2 (3)
- BCL2L1 (2)
- CASP9 (2)
- HDAC9 (2)
- AIFM1 (1)
- AMPD1 (1)
- ANGPT1 (1)
- ARRB2 (1)
- BECN1 (1)
- CASP3 (1)
- CASP6 (1)
- CRHR2 (1)
- DUOX2 (1)
- FLCN (1)
- GPR83 (1)
- HIPK3 (1)
- HSPA5 (1)
- HSPD1 (1)
- HSPE1 (1)
- HTR7 (1)
- KCNC1 (1)
- MAP2K1 (1)
- MAPK14 (1)
- MSR1 (1)
- MTSS1 (1)
- NQO1 (1)
- PLK1 (1)
- PPP3CA (1)
- RAB7A (1)
- S1PR5 (1)
- SCARB2 (1)
- SFN (1)
- SMAD2 (1)
- SNAI1 (1)
- SOD2 (1)
- SOX9 (1)
- SRI (1)
- STAT3 (1)
- TNFRSF1A (1)
- TNFRSF9 (1)
- TUBB (1)
- VDAC2 (1)
Isotypes
Pathways
- Apoptosis (9)
- Amyotrophic lateral sclerosis (ALS) (8)
- Pathways in cancer (8)
- Pancreatic cancer (7)
- MAPK signaling pathway (6)
- Alzheimer's disease (5)
- Colorectal cancer (5)
- Huntington's disease (5)
- VEGF signaling pathway (5)
- Neuroactive ligand-receptor interaction (4)
- Parkinson's disease (4)
- Small cell lung cancer (4)
- p53 signaling pathway (4)
- Calcium signaling pathway (3)
- Cell cycle (3)
- Chemokine signaling pathway (3)
- Chronic myeloid leukemia (3)
- Endometrial cancer (3)
- Jak-STAT signaling pathway (3)
- Natural killer cell mediated cytotoxicity (3)
- Non-small cell lung cancer (3)
- Oocyte meiosis (3)
- Progesterone-mediated oocyte maturation (3)
- Prostate cancer (3)
- T cell receptor signaling pathway (3)
- Viral myocarditis (3)
- Acute myeloid leukemia (2)
- Adherens junction (2)
- Adipocytokine signaling pathway (2)
- B cell receptor signaling pathway (2)
- Cytokine-cytokine receptor interaction (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Fc epsilon RI signaling pathway (2)
- Gap junction (2)
- GnRH signaling pathway (2)
- Long-term potentiation (2)
- Neurotrophin signaling pathway (2)
- Prion diseases (2)
- Renal cell carcinoma (2)
- Toll-like receptor signaling pathway (2)
- Wnt signaling pathway (2)
- Antigen processing and presentation (1)
- Axon guidance (1)
- Bladder cancer (1)
- Dorso-ventral axis formation (1)
- Endocytosis (1)
- ErbB signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Focal adhesion (1)
- Glioma (1)
- Insulin signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Lysosome (1)
- Melanogenesis (1)
- Melanoma (1)
- Metabolic pathways (1)
- NOD-like receptor signaling pathway (1)
- Olfactory transduction (1)
- Pathogenic Escherichia coli infection (1)
- Purine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- RNA degradation (1)
- Regulation of actin cytoskeleton (1)
- Regulation of autophagy (1)
- TGF-beta signaling pathway (1)
- Thyroid cancer (1)
- Type I diabetes mellitus (1)
- Vascular smooth muscle contraction (1)