Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Ku80 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal antibody to XRCC4 (X-ray repair complementing defective repair in Chinese hamster cells 4)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 216 and 309 of XRCC4 (Uniprot ID#Q13426) |
Rabbit Polyclonal Anti-Ku70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ku70 Antibody: A synthesized peptide derived from human Ku70 |
Rabbit Polyclonal Anti-Ku70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ku70 Antibody: A synthesized peptide derived from human Ku70 |
Rabbit Polyclonal Anti-DNA-PK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNA-PK Antibody: A synthesized peptide derived from human DNA-PK |
Rabbit Polyclonal Anti-MRE11A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRE11A Antibody: A synthesized peptide derived from human MRE11A |
Rabbit Polyclonal Anti-DNA PK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNA PK Antibody: A synthesized peptide derived from human DNA PK |
Rabbit Polyclonal Anti-Ku70/80 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ku70/80 Antibody: A synthesized peptide derived from human Ku70/80 |
Rabbit polyclonal DNA Polymerase lambda antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
Anti-RAD50 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae) |
Rabbit polyclonal anti-RAD50 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD50. |
Anti-LIG4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ligase IV, DNA, ATP-dependent |
Rabbit polyclonal anti-Mre11 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corres-ponding to amino acids 68-706 of mouse Mre11 protein. |
Rabbit Polyclonal Anti-XRCC4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XRCC4 antibody: synthetic peptide directed towards the middle region of human XRCC4. Synthetic peptide located within the following region: LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS |
Rabbit Polyclonal Ku80/XRCC5 Antibody
| Applications | IP |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to residues 323-338 [FSKVDEEQMKYKSEGK] of the 80 kDa Ku80 protein. |
Anti-XRCC6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human X-ray repair complementing defective repair in Chinese hamster cells 6 |
Anti-RAD50 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae) |
Rabbit Polyclonal Anti-MRE11A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MRE11A |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Non-homologous end-joining