Rabbit Polyclonal Anti-GNA13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNA13 |
Rabbit Polyclonal Anti-GNA13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNA13 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYL6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYL6 |
Rabbit anti-PRKCA Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human PRKCA |
Rabbit Polyclonal Anti-ADORA2B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit polyclonal anti-Actin-gamma2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Actin-?2. |
Anti-RHOA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Phospho-PRKCB-T641 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RAF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RAF1 |
Anti-RAMP1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 27-117 amino acids of human receptor (G protein-coupled) activity modifying protein 1 |
Rabbit anti-PPP1CB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CB |
PLCB1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCB1 |
Rabbit Polyclonal Anti-MYLK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Rabbit Polyclonal AGTR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1. |
Rabbit anti-PRKACB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKACB |
Rabbit Polyclonal Anti-alpha-SMA antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-alpha-SMA antibody: Synthetic peptide corresponding to N terminal residues of Human alpha smooth muscle Actin. |
Rabbit Polyclonal Anti-MAP2K1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAP2K1 |
Rabbit Polyclonal ROCK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit anti-MEK1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human MEK1 |
Rabbit Polyclonal Anti-AGTR1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
Rabbit polyclonal anti-EDNRA antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA. |
Rabbit anti-GNAS Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNAS |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PPP1CB (Clone EP1804Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2) |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit polyclonal anti-EDNRA antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA. |
Rabbit Polyclonal ROCK2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2. |
Rabbit polyclonal p44/42 MAPK antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human ERK1/2. |
Rabbit anti-PPP1CA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-ROCK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-MYLK2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYLK2 |
Rabbit Polyclonal antibody to RAMP2 (receptor (G protein-coupled) activity modifying protein 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 111 and 175 of RAMP2 (Uniprot ID#O60895) |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Ab-621) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
Modifications | Phospho-specific |
USD 345.00
In Stock
Rabbit polyclonal anti-PA2G6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PA2G6. |
Rabbit polyclonal anti-ARHGEF11 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ARHGEF11. |
Anti-PRKCQ (Phospho-Ser676) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 676 (R-L-S(p)-F-A) derived from Human PKC?. |
Modifications | Phospho-specific |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
Modifications | Phospho-specific |
Rabbit anti-PRKCE Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKCE |
Rabbit anti-PRKCB Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKCB |
Rabbit Polyclonal Anti-PRKCH Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Prkch antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAI |
Rabbit polyclonal anti-PKC d antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PKC d. |
Rabbit polyclonal PKCd (Ser645) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKCd around the phosphorylation site of serine 645 (R-L-SP-Y-S). |
Modifications | Phospho-specific |
Rabbit polyclonal PKC theta (Ser695) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC ? around the phosphorylation site of serine 695 (N-F-SP-F-M). |
Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit polyclonal anti-PLCB2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PLCB2. |
Rabbit polyclonal anti-PRKX antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKX. |