Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 515.00
In Stock
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
USD 432.00
In Stock
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal antibody to PAD4 (peptidyl arginine deiminase, type IV)
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 326 and 611 of PAD4 (Uniprot ID#Q9UM07) |
Rabbit Polyclonal Anti-KLF2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: PPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit Polyclonal Anti-TAF1 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE |
Rabbit Polyclonal Anti-SUZ12 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-MED17 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG |
Rabbit Polyclonal Anti-SMARCA1 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |
Rabbit Polyclonal Anti-TAF9 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Anti-Hdac6 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM |
Active filters
Reactivities
- Human
Applications
- Assay
Filter by
Category
Target Symbol
- MS4A1 (9)
- BTN3A2 (5)
- SERPINB3 (5)
- TP53 (5)
- CXCR4 (4)
- CTNNB1 (2)
- HDAC2 (2)
- HDAC6 (2)
- MED6 (2)
- SMARCA1 (2)
- TAF1 (2)
- ABCD3 (1)
- AGL (1)
- AK6 (1)
- ALOX5AP (1)
- AMBP (1)
- BST2 (1)
- CD5 (1)
- CTCF (1)
- CYP26C1 (1)
- DYM (1)
- EEF1G (1)
- EHMT2 (1)
- EZH1 (1)
- FBXO11 (1)
- GAPDH (1)
- H2AFZ (1)
- H2BC18 (1)
- HDAC4 (1)
- IL11RA (1)
- ITGAV (1)
- JUN (1)
- KLF2 (1)
- KLKB1 (1)
- LY75-CD302 (1)
- MBD4 (1)
- MCM7 (1)
- MED17 (1)
- MED19 (1)
- MYC (1)
- OCM2 (1)
- OGA (1)
- PADI4 (1)
- PAX8 (1)
- POT1 (1)
- PRKCG (1)
- RETN (1)
- SMARCA5 (1)
- SRF (1)
- STC1 (1)
- SUZ12 (1)
- TAF12 (1)
- TAF6 (1)
- THRB (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Families
- Druggable Genome (60)
- Transcription Factors (28)
- Transmembrane (25)
- ES Cell Differentiation/IPS (10)
- Secreted Protein (8)
- Stem cell - Pluripotency (8)
- GPCR (4)
- Protein Kinase (3)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Nuclear Hormone Receptor (1)
- Protease (1)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Pathways in cancer (14)
- Hematopoietic cell lineage (11)
- Wnt signaling pathway (10)
- Cell cycle (9)
- Colorectal cancer (9)
- MAPK signaling pathway (9)
- Thyroid cancer (9)
- Chronic myeloid leukemia (8)
- Endometrial cancer (8)
- Basal cell carcinoma (7)
- Huntington's disease (7)
- Leukocyte transendothelial migration (7)
- Prostate cancer (7)
- Small cell lung cancer (7)
- Bladder cancer (6)
- Glioma (6)
- Neurotrophin signaling pathway (6)
- Non-small cell lung cancer (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Apoptosis (5)
- Cytokine-cytokine receptor interaction (5)
- Focal adhesion (5)
- Melanoma (5)
- Pancreatic cancer (5)
- p53 signaling pathway (5)
- Axon guidance (4)
- Basal transcription factors (4)
- Chemokine signaling pathway (4)
- Endocytosis (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- ErbB signaling pathway (3)
- Melanogenesis (3)
- Tight junction (3)
- Adherens junction (2)
- Jak-STAT signaling pathway (2)
- Metabolic pathways (2)
- Notch signaling pathway (2)
- Pathogenic Escherichia coli infection (2)
- Systemic lupus erythematosus (2)
- ABC transporters (1)
- Acute myeloid leukemia (1)
- Alzheimer's disease (1)
- B cell receptor signaling pathway (1)
- Base excision repair (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Complement and coagulation cascades (1)
- DNA replication (1)
- Dilated cardiomyopathy (1)
- ECM-receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fc gamma R-mediated phagocytosis (1)
- Gap junction (1)
- Glycolysis / Gluconeogenesis (1)
- GnRH signaling pathway (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Phosphatidylinositol signaling system (1)
- Regulation of actin cytoskeleton (1)
- Renal cell carcinoma (1)
- Retinol metabolism (1)
- Starch and sucrose metabolism (1)
- T cell receptor signaling pathway (1)
- TGF-beta signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)