Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal H3K27me3S28p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me3 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3 antibody: against histone H3, trimethylated at lysine 27 (H3K27me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Rabbit Polyclonal H3K36me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K36me2 antibody: histone H3 containing the dimethylated lysine 36 (H3K36me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K4me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K4me2 antibody: histone H3 containing the dimethylated lysine 4 (H3K4me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K79me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K79me2 antibody: the region of histone H3 containing the dimethylated lysine 79 (H3K79me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K18ac antibody: the region of histone H3 containing the acetylated lysine 18 (H3K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3R17me2(asym)K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3R17me2(asym)K18ac antibody: the region of histone H3 containing the asymmetrically dimethylated R17 and the acetylated lysine 18 (H3R17me2(asym)K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K5,8,12ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K5,8,12ac antibody: the region of histone H4 containing the acetylated lysines 5, 8 and 12 (H4K5,8,12ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K20me3 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K20me3 antibody: the region of histone H4 containing the trimethylated lysine 20 (H4K20me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal Betatrophin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Betatrophin antibody was raised against a 16 amino acid peptide near the amino terminus of human Betatrophin. The immunogen is located within amino acids 40 - 90 of Betatrophin. |
Rabbit Polyclonal H3K9me1 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me1 antibody: histone H3 containing the monomethylated lysine 9 (H3K9me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9acS10p Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9acS10p antibody: histone H3 containing the acetylated lysine 9 and the phosphorylated serine 10 (H3K9acS10p), using a KLH-conjugated synthetic peptide |
Rabbit Polyclonal H3K9me3S10p Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me3S10p antibody: histone H3 containing trimethylated lysine 9 and the phosphorylated serine 10 (H3K9me3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me1 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me1 antibody: histone H3 containing the monomethylated lysine 27 (H3K27me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me2 antibody: the histone H3, dimethylated at lysine 27 (H3K27me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9me3 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me3 antibody: the region of histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K36me1 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K36me1 antibody: histone H3 containing the monomethylated lysine 36 (H3K36me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human LSD1 (Lysine-specific demethylase 1), using a KLH-conjugated synthetic peptide from the inner part of the protein. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal H3K4me3 Antibody
| Applications | Dot, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
Germany
Japan
United Kingdom
China
