Antibodies

View as table Download

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.

Rabbit Polyclonal Anti-EDA1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EDA1 antibody was raised against an 19 amino acid peptide near the center of human EDA1.

Rabbit Polyclonal Anti-IL-12A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A.

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A

USD 300.00

In Stock

Goat Polyclonal Anti-VEGFA Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit monoclonal antibody against VEGF (C-term)(EP1176Y)

Applications FC, IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-TNF12 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNF12.

Rabbit Polyclonal CCL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human CCL2.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit Polyclonal IL-1RAcP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-1RAcP antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of IL-1RAcP, which differs from the sequence of mouse origin by three amino acids.

Rabbit Polyclonal BAFF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF.

Rabbit Polyclonal TWEAK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen TWEAK antibody was raised against recombinant human TWEAK protein.

Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T).
Modifications Phospho-specific

Rabbit polyclonal anti-TNFSF13 / TALL-2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TALL-2.

Rabbit polyclonal anti-TNFRSF6B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TNFRSF6B.

Rabbit Polyclonal IL-22 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-22 antibody was raised against a 17 amino acid peptide near the center of human IL-22

Rabbit anti-IFNB1 Polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNB1

Rabbit Polyclonal IL-21 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal anti-TNF14 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNF14

Rabbit Polyclonal LIF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIF antibody was raised against a 16 amino acid synthetic peptide near the center of human LIF.

Rabbit polyclonal CCL2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2.

Rabbit Polyclonal IL-9 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9.

IL23 (IL23A) (C-term) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen A 14 amino acid peptide from near the carboxy-terminus of human IL-23

Rabbit Polyclonal IL-1RAcP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-1RAcP antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-1RAcP. The immunogen is located within the last 50 amino acids of IL-1RAcP.

Rabbit Polyclonal IL-23 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-23 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human IL-23.

Rabbit Polyclonal IL-23 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-23 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-23.

Rabbit Polyclonal TSLP Receptor Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TSLP Receptor antibody was raised against a 19 amino acid peptide from near the center of human TSLP receptor.

Rabbit Polyclonal IL-17 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-17 antibody was raised against a 19 amino acid synthetic peptide from near the center of human IL-17A. The immunogen is located within amino acids 50 - 100 of IL-17.

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Rabbit Polyclonal antibody to PF4V1 (platelet factor 4 variant 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 40 and 104 of PF4V1 (Uniprot ID#P10720)

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.

Rabbit Polyclonal CCL17 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL17 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CCL17.

Rabbit Polyclonal Eotaxin Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin.

Rabbit polyclonal TNF Receptor II antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TNF Receptor II.

Rabbit polyclonal EGFR (Thr678) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 678 (K-R-TP-L-R).
Modifications Phospho-specific

Rabbit Polyclonal IL-28B Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-28B antibody was raised against a 17 amino acid peptide near the center of human IL-28B.

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG

Rabbit Polyclonal Anti-IL-11 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-11 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-11. The immunogen is located within amino acids 40 - 90 of IL-11.

Anti-FLT1 Rabbit Polyclonal Antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1303-1316 amino acids of human fms-related tyrosine kinase 1