Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
ALK mouse monoclonal antibody, clone OTI1A4
Applications | IHC, LMNX, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-ZO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli. |
Carrier-free (BSA/glycerol-free) CD1C mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
KRT8/CK8 mouse monoclonal antibody, clone UMAB1
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTLA4 mouse monoclonal antibody,clone UMAB249
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Purified CD20 (MS4A1) mouse monoclonal antibody,clone UMAB58
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-ERCC1 mouse monoclonal antibody, clone 4F9
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Mouse Monoclonal ABCG2/CD338 Antibody (3G8)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
USD 420.00
In Stock
LIPG mouse monoclonal antibody, clone 9C5, Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Biotin |
Carrier-free (BSA/glycerol-free) CD20 mouse monoclonal antibody,clone UMAB38
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit anti-Nono Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A specific peptide of human Nono |
Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Rabbit Polyclonal Lipase A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571] |
Rabbit anti-REG3A Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human REG3A |
Rabbit anti-IRF3 Polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF3 |
Mouse Monoclonal Osteopontin Antibody (1B20)
Applications | IHC, WB |
Reactivities | Human, Rabbit, Rat |
Conjugation | Unconjugated |
USD 479.00
2 Weeks
Mouse Monoclonal Antibody against Telomerase reverse transcriptase (2C4) - Embryonic Stem Cell Marker
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal IRAK-M Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
Rabbit Polyclonal Nephrin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-Rab27a Antibody
Applications | IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli. |
Rabbit Polyclonal Ogg1 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human Ogg1 (within amino acids 1-100). |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |