Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
USD 380.00
In Stock
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
MCP-2 / CCL8 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
IL-17 Mouse Monoclonal (aa1-75) (4K5F6) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Active filters
Category
- Antibodies
Applications
- IHC
Families
- Secreted Protein
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (59)
- CD40 (40)
- CSF2 (24)
- TNF (19)
- CSF1 (17)
- CSF3 (17)
- IL1A (16)
- IL24 (15)
- IL2 (13)
- IL20 (13)
- PRL (13)
- VEGFB (12)
- IL6 (11)
- CCL19 (10)
- CXCL12 (9)
- IL12A (9)
- TNFRSF18 (9)
- VEGFA (9)
- EPOR (8)
- IL12B (8)
- LEP (8)
- VEGFC (8)
- IL23A (7)
- OSM (7)
- TNFSF13 (7)
- VEGFD (7)
- CCL2 (6)
- FASLG (6)
- GH2 (6)
- IL10 (6)
- IL17A (6)
- IL17B (6)
- IL1B (6)
- TGFB1 (6)
- TNFRSF11B (6)
- TNFRSF1A (6)
- CRLF2 (5)
- FLT1 (5)
- GH1 (5)
- IL3 (5)
- AMH (4)
- CCL20 (4)
- EDA (4)
- IFNB1 (4)
- IFNG (4)
- IL4 (4)
- INHBA (4)
- LEPR (4)
- TGFB3 (4)
- TNFRSF1B (4)
- TNFRSF6B (4)
- TNFSF14 (4)
- BMP2 (3)
- BMP7 (3)
- CCL1 (3)
- CCL17 (3)
- CCL21 (3)
- CCL5 (3)
- CSF3R (3)
- CX3CL1 (3)
- CXCL8 (3)
- FAS (3)
- IL6ST (3)
- LTA (3)
- TNFSF12 (3)
- CCL15 (2)
- CCL4 (2)
- CCL7 (2)
- CD40LG (2)
- CTF1 (2)
- CXCL14 (2)
- CXCL3 (2)
- CXCL5 (2)
- EPO (2)
- IFNA2 (2)
- IL15 (2)
- IL15RA (2)
- IL22 (2)
- IL22RA2 (2)
- IL25 (2)
- IL5 (2)
- IL9R (2)
- INHBB (2)
- INHBC (2)
- LIF (2)
- PF4 (2)
- TGFB2 (2)
- CCL11 (1)
- CCL13 (1)
- CCL14 (1)
- CCL16 (1)
- CCL18 (1)
- CCL23 (1)
- CCL25 (1)
- CCL26 (1)
- CCL28 (1)
- CCL3 (1)
- CCL8 (1)
- CSF2RA (1)
- CXCL1 (1)