Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (173)
- ERBB2 (99)
- CTNNB1 (71)
- AKT1 (64)
- JUN (63)
- BCL2 (51)
- PIK3CG (51)
- PARVA (50)
- PIK3R5 (36)
- EGFR (33)
- MAPK1 (29)
- BRAF (28)
- MAPK9 (27)
- PIK3CD (27)
- HRAS (26)
- PARVB (25)
- BCAR1 (24)
- HGF (22)
- PIK3CA (21)
- FN1 (18)
- MET (18)
- PTK2 (17)
- VASP (16)
- MYL7 (15)
- PDGFRA (15)
- RAPGEF1 (15)
- MAPK8 (13)
- SHC1 (13)
- IGF1 (12)
- ITGB3 (12)
- VEGFB (12)
- AKT2 (9)
- AKT3 (9)
- BAD (9)
- PAK1 (8)
- PDGFRB (8)
- ACTN1 (7)
- MAPK3 (7)
- PTEN (7)
- ACTB (6)
- CAV1 (6)
- KDR (6)
- LAMA4 (6)
- PAK4 (6)
- PPP1CA (6)
- PRKCA (6)
- SRC (6)
- VEGFC (6)
- CAPN2 (5)
- COL1A1 (5)
- GSK3B (5)
- LAMB2 (5)
- PXN (5)
- RAF1 (5)
- ROCK2 (5)
- CCND3 (4)
- IGF1R (4)
- ILK (4)
- PAK2 (4)
- PIK3R1 (4)
- PPP1CB (4)
- VEGFA (4)
- BIRC2 (3)
- CCND1 (3)
- COL4A1 (3)
- ELK1 (3)
- GRB2 (3)
- LAMA1 (3)
- PAK5 (3)
- PDPK1 (3)
- SPP1 (3)
- THBS1 (3)
- TNC (3)
- TNXB (3)
- XIAP (3)
- ACTN2 (2)
- ACTN4 (2)
- CAV3 (2)
- CCND2 (2)
- COL2A1 (2)
- COL3A1 (2)
- DOCK1 (2)
- EGF (2)
- FYN (2)
- ITGA7 (2)
- ITGB1 (2)
- ITGB4 (2)
- LAMA3 (2)
- LAMA5 (2)
- LAMB3 (2)
- MYL9 (2)
- PAK3 (2)
- PDGFA (2)
- PPP1CC (2)
- PRKCB (2)
- RAC1 (2)
- RAP1A (2)
- RAP1B (2)
- ROCK1 (2)
- TNN (2)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1323)
- Protein Kinase (628)
- ES Cell Differentiation/IPS (530)
- Transmembrane (297)
- Transcription Factors (139)
- Secreted Protein (119)
- Stem cell - Pluripotency (85)
- Adult stem cells (58)
- Stem cell relevant signaling - JAK/STAT signaling pathway (42)
- Cancer stem cells (33)
- Protease (27)
- Phosphatase (19)
- Embryonic stem cells (3)
- Induced pluripotent stem cells (3)
- Stem cell relevant signaling - DSL/Notch pathway (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)