Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
.jpg?d=110x100 "User supplied image")
USD 250.00
2 Weeks
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
USD 479.00
2 Weeks
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
USD 380.00
2 Weeks
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Active filters
Applications
- IHC
Families
- Druggable Genome
Citations
- Yes
Filter by
Category
Target Symbol
- MKI67 (9)
- TP53 (9)
- BAX (7)
- LGR5 (7)
- CD19 (5)
- CD4 (5)
- CDH2 (5)
- CHGA (5)
- COL1A1 (5)
- CTNNB1 (5)
- PECAM1 (5)
- ALDH1A3 (4)
- BECN1 (4)
- CA9 (4)
- CCN2 (4)
- CD163 (4)
- CD274 (4)
- CD8A (4)
- CDH1 (4)
- CLEC4E (4)
- ERBB2 (4)
- GBE1 (4)
- IL6 (4)
- KRT8 (4)
- LTA4H (4)
- MAPK1 (4)
- MME (4)
- PDE10A (4)
- RELA (4)
- SLC7A8 (4)
- SNAI2 (4)
- SPP1 (4)
- UNG (4)
- ZEB2 (4)
- AKT1 (3)
- ALK (3)
- ANXA1 (3)
- BCL2 (3)
- BIRC5 (3)
- CD3E (3)
- CD44 (3)
- CD68 (3)
- CDH3 (3)
- CDKN2A (3)
- CTLA4 (3)
- EPAS1 (3)
- ERCC1 (3)
- FGF2 (3)
- GBA (3)
- HNRNPM (3)
- HSPD1 (3)
- IDO1 (3)
- IL1B (3)
- LAMB3 (3)
- MGMT (3)
- MMP2 (3)
- MS4A1 (3)
- MSR1 (3)
- NCAM1 (3)
- NOTCH1 (3)
- NR4A3 (3)
- PARP1 (3)
- PDCD1 (3)
- PGR (3)
- PPP4C (3)
- PTCH1 (3)
- SNAI1 (3)
- STAT3 (3)
- ABCC4 (2)
- ABCD1 (2)
- ABCG2 (2)
- ACTN1 (2)
- ADH1B (2)
- ADIPOQ (2)
- AKT3 (2)
- ALDH3A1 (2)
- ALOX15 (2)
- AOX1 (2)
- APOE (2)
- AQP1 (2)
- ARNT (2)
- ARNTL (2)
- BAG3 (2)
- BCAT1 (2)
- BCL2L1 (2)
- BDNF (2)
- BID (2)
- BTK (2)
- BTN3A2 (2)
- CAMK2A (2)
- CASP3 (2)
- CAT (2)
- CCNB1 (2)
- CCR6 (2)
- CD1C (2)
- CD34 (2)
- CD40 (2)
- CD7 (2)
- CD74 (2)
- CD81 (2)
Reactivities
- Human (739)
- Mouse (489)
- Rat (439)
- Monkey (89)
- Dog (75)
- Bovine (17)
- Pig (8)
- Rabbit (8)
- Canine (6)
- Gorilla (6)
- Hamster (5)
- Primate (5)
- Xenopus (5)
- Chicken (4)
- Porcine (4)
- Rhesus Monkey (4)
- Chimpanzee (3)
- Horse (3)
- Bat (2)
- Cow (2)
- Guinea Pig (2)
- Zebrafish (2)
- Escherichia coli (1)
- Gibbon (1)
- Helicobacter pylori (1)
- Mink (1)
- Orang-Utan (1)
- Salmonella Typhimurium (1)
- Spinach (1)
- Trichinella spiralis (1)
- White Fly (1)
- X. tropicalis (1)
- Yeast (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (146)
- Metabolic pathways (92)
- Focal adhesion (74)
- MAPK signaling pathway (67)
- Cell adhesion molecules (CAMs) (60)
- Prostate cancer (60)
- Colorectal cancer (58)
- Neurotrophin signaling pathway (58)
- Pancreatic cancer (53)
- Apoptosis (52)
- Hematopoietic cell lineage (51)
- Melanoma (50)
- Small cell lung cancer (48)
- T cell receptor signaling pathway (48)
- Endometrial cancer (46)
- Toll-like receptor signaling pathway (46)
- Chronic myeloid leukemia (45)
- Glioma (45)
- Regulation of actin cytoskeleton (44)
- Adherens junction (42)
- Chemokine signaling pathway (42)
- Bladder cancer (41)
- Non-small cell lung cancer (39)
- Cytokine-cytokine receptor interaction (38)
- p53 signaling pathway (38)
- B cell receptor signaling pathway (35)
- ErbB signaling pathway (35)
- Amyotrophic lateral sclerosis (ALS) (33)
- Huntington's disease (33)
- Leukocyte transendothelial migration (32)
- Progesterone-mediated oocyte maturation (32)
- Renal cell carcinoma (32)
- Thyroid cancer (31)
- Insulin signaling pathway (30)
- Prion diseases (30)
- Acute myeloid leukemia (29)
- ECM-receptor interaction (29)
- Gap junction (28)
- Jak-STAT signaling pathway (28)
- Adipocytokine signaling pathway (27)
- Alzheimer's disease (27)
- Primary immunodeficiency (27)
- Natural killer cell mediated cytotoxicity (26)
- NOD-like receptor signaling pathway (25)
- VEGF signaling pathway (25)
- Wnt signaling pathway (24)
- Axon guidance (23)
- Fc epsilon RI signaling pathway (23)
- Melanogenesis (23)
- Basal cell carcinoma (22)
- Endocytosis (22)
- Cell cycle (21)
- Fc gamma R-mediated phagocytosis (21)
- Pathogenic Escherichia coli infection (21)
- Tight junction (21)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (20)
- Drug metabolism - cytochrome P450 (20)
- GnRH signaling pathway (20)
- Oocyte meiosis (19)
- TGF-beta signaling pathway (18)
- Arachidonic acid metabolism (17)
- Calcium signaling pathway (17)
- Metabolism of xenobiotics by cytochrome P450 (17)
- Antigen processing and presentation (16)
- Cytosolic DNA-sensing pathway (16)
- Dorso-ventral axis formation (16)
- Lysosome (16)
- Neuroactive ligand-receptor interaction (16)
- Purine metabolism (16)
- Type II diabetes mellitus (16)
- Viral myocarditis (16)
- mTOR signaling pathway (16)
- Epithelial cell signaling in Helicobacter pylori infection (15)
- Glycolysis / Gluconeogenesis (15)
- Hypertrophic cardiomyopathy (HCM) (14)
- Long-term potentiation (14)
- Type I diabetes mellitus (14)
- Complement and coagulation cascades (13)
- Graft-versus-host disease (12)
- Long-term depression (12)
- RIG-I-like receptor signaling pathway (12)
- Retinol metabolism (12)
- Tyrosine metabolism (12)
- Vascular smooth muscle contraction (12)
- Dilated cardiomyopathy (11)
- Autoimmune thyroid disease (10)
- Base excision repair (10)
- PPAR signaling pathway (9)
- Parkinson's disease (9)
- Tryptophan metabolism (9)
- Ubiquitin mediated proteolysis (9)
- Allograft rejection (8)
- Hedgehog signaling pathway (8)
- Pyrimidine metabolism (8)
- ABC transporters (7)
- Histidine metabolism (7)
- Linoleic acid metabolism (7)
- Phosphatidylinositol signaling system (7)
- Starch and sucrose metabolism (7)
- Systemic lupus erythematosus (7)
- Alanine (6)
- Phenylalanine metabolism (6)
- Regulation of autophagy (6)
- Sphingolipid metabolism (6)
- Valine (6)
- aspartate and glutamate metabolism (6)
- leucine and isoleucine degradation (6)
- Cysteine and methionine metabolism (5)
- Fatty acid metabolism (5)
- Inositol phosphate metabolism (5)
- Notch signaling pathway (5)
- Nucleotide excision repair (5)
- Other glycan degradation (5)
- Primary bile acid biosynthesis (5)
- Renin-angiotensin system (5)
- Asthma (4)
- Butanoate metabolism (4)
- Cardiac muscle contraction (4)
- Fructose and mannose metabolism (4)
- Nitrogen metabolism (4)
- Oxidative phosphorylation (4)
- Pantothenate and CoA biosynthesis (4)
- Propanoate metabolism (4)
- Pyruvate metabolism (4)
- Vibrio cholerae infection (4)
- beta-Alanine metabolism (4)
- Circadian rhythm - mammal (3)
- Citrate cycle (TCA cycle) (3)
- Drug metabolism - other enzymes (3)
- Galactose metabolism (3)
- Methane metabolism (3)
- One carbon pool by folate (3)
- Porphyrin and chlorophyll metabolism (3)
- RNA degradation (3)
- Spliceosome (3)
- Taurine and hypotaurine metabolism (3)
- Arginine and proline metabolism (2)
- C21-Steroid hormone metabolism (2)
- Caffeine metabolism (2)
- Folate biosynthesis (2)
- Glutathione metabolism (2)
- Homologous recombination (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Olfactory transduction (2)
- Pentose phosphate pathway (2)
- SNARE interactions in vesicular transport (2)
- Vitamin B6 metabolism (2)
- leucine and isoleucine biosynthesis (2)
- Androgen and estrogen metabolism (1)
- Ascorbate and aldarate metabolism (1)
- DNA replication (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycine (1)
- Glycosaminoglycan degradation (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Limonene and pinene degradation (1)
- Lysine degradation (1)
- Non-homologous end-joining (1)
- Proteasome (1)
- Riboflavin metabolism (1)
- Selenoamino acid metabolism (1)
- Steroid biosynthesis (1)
- Thiamine metabolism (1)
- serine and threonine metabolism (1)