Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal Anti-CTDSPL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit polyclonal antibody to myotubularin related protein 4 (myotubularin related protein 4)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 281 and 578 of myotubularin related protein 4 (Uniprot ID#Q9NYA4) |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
| Modifications | Phospho-specific |
Rabbit polyclonal SSH3 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SSH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 575-602 amino acids from the C-terminal region of human SSH3. |
Rabbit polyclonal PTP4A2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PTP4A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-59 amino acids from the Central region of human PTP4A2. |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Goat Polyclonal Antibody against DUSP16
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AHEMIGTQIVTER-C, from the N Terminus of the protein sequence according to NP_085143.1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Clonalities
- Polyclonal
Families
- Phosphatase
Filter by
Target Symbol
- CDC25A (7)
- PTEN (6)
- PTPN11 (6)
- DUSP1 (5)
- PPP4C (5)
- PTPRM (5)
- PPP3CA (4)
- PTPN13 (4)
- PTPRE (4)
- SET (4)
- CDC25B (3)
- CTDSP1 (3)
- DUSP26 (3)
- DUSP4 (3)
- DUSP6 (3)
- PPP1CB (3)
- PPP2CA (3)
- PPP2R1A (3)
- PPP2R1B (3)
- PTP4A2 (3)
- PTPRC (3)
- PTPRJ (3)
- ACP1 (2)
- ACPP (2)
- CDC25C (2)
- DUSP12 (2)
- DUSP16 (2)
- DUSP22 (2)
- DUSP23 (2)
- DUSP8 (2)
- MTMR4 (2)
- MTMR9 (2)
- PDP1 (2)
- PPM1F (2)
- PPP1CA (2)
- PPP1CC (2)
- PPP2CB (2)
- PPP3CC (2)
- PPP6C (2)
- PTPN20 (2)
- PTPRK (2)
- SIRPA (2)
- SSH3 (2)
- CDKN3 (1)
- CTDSP2 (1)
- CTDSPL (1)
- DAPP1 (1)
- DUSP10 (1)
- DUSP11 (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP15 (1)
- DUSP19 (1)
- DUSP2 (1)
- DUSP3 (1)
- DUSP7 (1)
- DUSP9 (1)
- EYA1 (1)
- EYA3 (1)
- EYA4 (1)
- ILKAP (1)
- MTMR2 (1)
- MTMR7 (1)
- PPFIA1 (1)
- PPM1H (1)
- PPM1K (1)
- PPM1L (1)
- PPP1R1C (1)
- PPP2R2A (1)
- PPP2R2B (1)
- PPP2R3A (1)
- PPP3CB (1)
- PPP3R2 (1)
- PTN (1)
- PTPN1 (1)
- PTPN12 (1)
- PTPN2 (1)
- PTPN22 (1)
- PTPN3 (1)
- PTPN4 (1)
- PTPN5 (1)
- PTPN6 (1)
- PTPN7 (1)
- PTPRA (1)
- PTPRR (1)
Reactivities
Antibody Hosts
Conjugates
Modifications
Pathways
- MAPK signaling pathway (35)
- Oocyte meiosis (28)
- Tight junction (19)
- Wnt signaling pathway (19)
- Long-term potentiation (15)
- Natural killer cell mediated cytotoxicity (15)
- Focal adhesion (13)
- Adherens junction (12)
- Cell cycle (12)
- Progesterone-mediated oocyte maturation (12)
- T cell receptor signaling pathway (12)
- Long-term depression (11)
- TGF-beta signaling pathway (11)
- B cell receptor signaling pathway (10)
- Regulation of actin cytoskeleton (9)
- Alzheimer's disease (8)
- Amyotrophic lateral sclerosis (ALS) (8)
- Apoptosis (8)
- Axon guidance (8)
- Calcium signaling pathway (8)
- Cell adhesion molecules (CAMs) (8)
- Insulin signaling pathway (8)
- VEGF signaling pathway (8)
- Jak-STAT signaling pathway (7)
- Vascular smooth muscle contraction (7)
- Adipocytokine signaling pathway (6)
- Chronic myeloid leukemia (6)
- Endometrial cancer (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Glioma (6)
- Inositol phosphate metabolism (6)
- Leukocyte transendothelial migration (6)
- Melanoma (6)
- Neurotrophin signaling pathway (6)
- Pathways in cancer (6)
- Phosphatidylinositol signaling system (6)
- Prostate cancer (6)
- Renal cell carcinoma (6)
- Riboflavin metabolism (6)
- Small cell lung cancer (6)
- p53 signaling pathway (6)
- Fc gamma R-mediated phagocytosis (3)
- Primary immunodeficiency (3)
- Fructose and mannose metabolism (2)
- Metabolic pathways (2)
- Thiamine metabolism (2)