Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit polyclonal CDK5 (Ab-15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T) |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Rabbit Polyclonal Anti-ATP2A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PEK/PERK (Thr981) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PEK/PERK around the phosphorylation site of threonine 981 (R-H-TP-G-Q). |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Clonalities
- Polyclonal
Pathways
- Alzheimer's disease
Filter by
Target Symbol
- BAD (16)
- CASP9 (14)
- APP (12)
- CASP3 (12)
- GAPDH (12)
- CASP7 (11)
- GRIN1 (10)
- APAF1 (9)
- GSK3B (8)
- TNF (8)
- COX4I1 (7)
- CDK5 (6)
- MAPT (6)
- MME (6)
- TNFRSF1A (6)
- CASP8 (5)
- HSD17B10 (5)
- NOS2 (5)
- ATF6 (4)
- ATP5PF (4)
- BACE1 (4)
- BACE2 (4)
- COX6B1 (4)
- CYCS (4)
- EIF2AK3 (4)
- GRIN2A (4)
- MAPK1 (4)
- NDUFA10 (4)
- PLCB3 (4)
- PPP3CA (4)
- SNCA (4)
- APOE (3)
- BID (3)
- CACNA1C (3)
- FADD (3)
- FAS (3)
- IL1B (3)
- MAPK3 (3)
- NAE1 (3)
- NCSTN (3)
- NDUFA8 (3)
- NDUFB9 (3)
- NDUFS1 (3)
- NDUFS2 (3)
- NDUFS4 (3)
- NDUFS8 (3)
- NOS3 (3)
- PSEN1 (3)
- SDHA (3)
- ADAM10 (2)
- APH1A (2)
- ATP2A1 (2)
- ATP5F1A (2)
- ATP5F1C (2)
- ATP5F1D (2)
- CAPN1 (2)
- CHP1 (2)
- COX5A (2)
- COX5B (2)
- COX7B (2)
- COX7B2 (2)
- GRIN2B (2)
- GRIN2C (2)
- GRIN2D (2)
- IDE (2)
- ITPR2 (2)
- NDUFA5 (2)
- NDUFA9 (2)
- NDUFAB1 (2)
- NDUFC2 (2)
- NDUFS5 (2)
- NDUFS6 (2)
- NDUFV2 (2)
- PPP3CC (2)
- PSENEN (2)
- SDHB (2)
- SDHD (2)
- ADAM17 (1)
- ATP2A2 (1)
- ATP2A3 (1)
- ATP5F1B (1)
- ATP5MC2 (1)
- ATP5MC3 (1)
- ATP5PD (1)
- CACNA1D (1)
- CACNA1S (1)
- CALM1 (1)
- CALML5 (1)
- CDK5R1 (1)
- COX6A1 (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7A2L (1)
- COX8A (1)
- ITPR1 (1)
- ITPR3 (1)
- LCMT2 (1)
- LRP1 (1)
- NDUFA1 (1)
Reactivities
Antibody Hosts
Conjugates
Modifications
Families
- Druggable Genome (261)
- Transmembrane (114)
- Protease (69)
- ES Cell Differentiation/IPS (32)
- Secreted Protein (27)
- Protein Kinase (25)
- Ion Channels: Glutamate Receptors (20)
- Transcription Factors (19)
- Stem cell - Pluripotency (17)
- Phosphatase (8)
- Ion Channels: Calcium (5)
- Ion Channels: Sodium (4)
- Adult stem cells (3)