Germany
Japan
United Kingdom
China
Antibodies
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-PNPLA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
Active filters
Reactivities
- Human
Applications
- IHC
Clonalities
- Polyclonal
Filter by
Target Symbol
- AKT1 (30)
- TP53 (23)
- H3-4 (19)
- JUN (19)
- RELA (19)
- CASP3 (16)
- HIF1A (16)
- HISTONE H3 (15)
- STAT1 (15)
- STAT3 (15)
- BAD (14)
- EIF4EBP1 (14)
- ESR1 (14)
- HIST2H3A (14)
- IRS1 (14)
- CREB1 (13)
- CXCR4 (13)
- GSK3B (13)
- HDAC2 (13)
- MAP1LC3B (13)
- TNF (13)
- YAP1 (13)
- APP (12)
- ATF2 (12)
- BAX (12)
- BRAF (12)
- BRCA1 (12)
- CASP9 (12)
- FOXO1 (12)
- GCG (12)
- HSPB1 (12)
- MAPK14 (12)
- MMP9 (12)
- NR3C1 (12)
- RB1 (12)
- SMAD3 (12)
- XRCC6 (12)
- ATG5 (11)
- BCL2 (11)
- EGFR (11)
- ERBB2 (11)
- NFKBIA (11)
- RPS6KB1 (11)
- STAT5B (11)
- STMN1 (11)
- TGFB1 (11)
- TLR4 (11)
- TRPM8 (11)
- VASP (11)
- AGR2 (10)
- ALK (10)
- BDNF (10)
- CASP1 (10)
- GFAP (10)
- HDAC5 (10)
- HSPD1 (10)
- JAK2 (10)
- KDR (10)
- KEAP1 (10)
- MKI67 (10)
- NFKB1 (10)
- NOS2 (10)
- NOTCH1 (10)
- PIAS3 (10)
- PIK3R1 (10)
- PTEN (10)
- SOX2 (10)
- BCL2L11 (9)
- CASP7 (9)
- CCNB1 (9)
- CCNE1 (9)
- CD44 (9)
- CDKN2A (9)
- FOS (9)
- H3C1 (9)
- HSP90AB1 (9)
- HSPA1A (9)
- KRT18 (9)
- LOX (9)
- MAP1LC3A (9)
- MAPK1 (9)
- MEF2C (9)
- MUC1 (9)
- NBN (9)
- NGF (9)
- NTRK1 (9)
- PAK1 (9)
- PTGS1 (9)
- RPS6KA1 (9)
- SMC1A (9)
- TLR2 (9)
- TSC2 (9)
- UBB (9)
- VEGFA (9)
- VIM (9)
- AKT2 (8)
- APC (8)
- ARRB1 (8)
- CALB1 (8)
- CANX (8)
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (2309)
- Phospho-specific (456)
- Acetyl K12 (2)
- Acetyl K5 (2)
- Phospho S127 (2)
- Phospho S39 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- TriMethyl K56 (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- Pan DiMethyl-lysine (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S104 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S15 (1)
- Phospho S157 (1)
- Phospho S182 (1)
- Phospho S240/244 (1)
- Phospho S243 (1)
- Phospho S280 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S37 (1)
- Phospho S376 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S455 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S5 (1)
- Phospho S51 (1)
- Phospho S529 (1)
- Phospho S612 (1)
- Phospho S62 (1)
- Phospho S73 (1)
- Phospho S80 (1)
- Phospho S82 (1)
- Phospho S89 (1)
- Phospho S957 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T17 (1)
- Phospho T179 (1)
- Phospho T18/S19 (1)
- Phospho T183/T172 (1)
- Phospho T1989 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T286 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T37/46 (1)
- Phospho T389 (1)
- Phospho T45 (1)
- Phospho T58 (1)
- Phospho T6 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T70 (1)
- Phospho T91 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1217 (1)
- Phospho Y1349 (1)
- Phospho Y15 (1)
- Phospho Y182 (1)
- Phospho Y207 (1)
- Phospho Y245 (1)
- Phospho Y412 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- phospho T1079,Phospho T1041 (1)
Assay Types
Families
- Druggable Genome (7564)
- Transmembrane (3360)
- Transcription Factors (1760)
- Secreted Protein (1205)
- Protein Kinase (836)
- ES Cell Differentiation/IPS (740)
- GPCR (496)
- Stem cell - Pluripotency (486)
- Protease (438)
- Adult stem cells (165)
- Embryonic stem cells (124)
- Nuclear Hormone Receptor (114)
- Phosphatase (111)
- Cancer stem cells (104)
- Induced pluripotent stem cells (92)
- Ion Channels: Other (90)
- Stem cell relevant signaling - JAK/STAT signaling pathway (77)
- Ion Channels: Transient receptor potential (59)
- P450 (59)
- Ion Channels: Potassium (58)
- Stem cell relevant signaling - DSL/Notch pathway (46)
- Stem cell relevant signaling - Wnt Signaling pathway (46)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (43)
- Ion Channels: Cys-loop Receptors (32)
- Ion Channels: Glutamate Receptors (31)
- Ion Channels: Sodium (20)
- Ion Channels: Cyclic nucleotide gated (10)
- Ion Channels: ATP Receptors (8)
- Ion Channels: Calcium (8)
Pathways
- Pathways in cancer (926)
- Metabolic pathways (925)
- MAPK signaling pathway (562)
- Focal adhesion (441)
- Neuroactive ligand-receptor interaction (441)
- Cytokine-cytokine receptor interaction (420)
- Chemokine signaling pathway (399)
- Neurotrophin signaling pathway (363)
- Regulation of actin cytoskeleton (340)
- Prostate cancer (339)
- Cell cycle (303)
- Apoptosis (302)
- Wnt signaling pathway (295)
- Colorectal cancer (294)
- Toll-like receptor signaling pathway (294)
- Chronic myeloid leukemia (293)
- Jak-STAT signaling pathway (289)
- Insulin signaling pathway (287)
- Calcium signaling pathway (280)
- Pancreatic cancer (279)
- T cell receptor signaling pathway (276)
- Small cell lung cancer (275)
- Alzheimer's disease (269)
- ErbB signaling pathway (267)
- Endocytosis (265)
- Huntington's disease (259)
- Leukocyte transendothelial migration (243)
- Acute myeloid leukemia (225)
- Progesterone-mediated oocyte maturation (225)
- Adipocytokine signaling pathway (221)
- Melanoma (212)
- Endometrial cancer (201)
- B cell receptor signaling pathway (200)
- p53 signaling pathway (200)
- Melanogenesis (199)
- Fc gamma R-mediated phagocytosis (197)
- Glioma (197)
- Natural killer cell mediated cytotoxicity (196)
- Tight junction (195)
- Non-small cell lung cancer (194)
- Renal cell carcinoma (194)
- Oocyte meiosis (188)
- Ubiquitin mediated proteolysis (186)
- Axon guidance (185)
- VEGF signaling pathway (178)
- Amyotrophic lateral sclerosis (ALS) (174)
- GnRH signaling pathway (173)
- Parkinson's disease (169)
- Vascular smooth muscle contraction (169)
- mTOR signaling pathway (167)
- Adherens junction (164)
- NOD-like receptor signaling pathway (164)
- Gap junction (163)
- RIG-I-like receptor signaling pathway (159)
- TGF-beta signaling pathway (158)
- Cell adhesion molecules (CAMs) (152)
- Fc epsilon RI signaling pathway (152)
- Bladder cancer (149)
- Epithelial cell signaling in Helicobacter pylori infection (142)
- Basal cell carcinoma (133)
- Long-term potentiation (129)
- Purine metabolism (128)
- Pathogenic Escherichia coli infection (126)
- Dilated cardiomyopathy (120)
- PPAR signaling pathway (118)
- Hematopoietic cell lineage (115)
- Type II diabetes mellitus (115)
- Long-term depression (114)
- ECM-receptor interaction (111)
- Systemic lupus erythematosus (109)
- Hypertrophic cardiomyopathy (HCM) (108)
- Cytosolic DNA-sensing pathway (105)
- Glycolysis / Gluconeogenesis (103)
- Complement and coagulation cascades (101)
- Hedgehog signaling pathway (101)
- Lysosome (100)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (99)
- Antigen processing and presentation (98)
- Viral myocarditis (96)
- Notch signaling pathway (88)
- Oxidative phosphorylation (82)
- Spliceosome (79)
- Thyroid cancer (79)
- Metabolism of xenobiotics by cytochrome P450 (77)
- Prion diseases (76)
- Arginine and proline metabolism (75)
- Drug metabolism - cytochrome P450 (74)
- Type I diabetes mellitus (68)
- Phosphatidylinositol signaling system (65)
- Fatty acid metabolism (62)
- Regulation of autophagy (61)
- Tyrosine metabolism (60)
- Arachidonic acid metabolism (59)
- Valine (59)
- Vibrio cholerae infection (59)
- Alanine (58)
- Cardiac muscle contraction (58)
- Pyruvate metabolism (58)
- aspartate and glutamate metabolism (58)
- Pyrimidine metabolism (57)
- leucine and isoleucine degradation (54)
- Dorso-ventral axis formation (52)
- Retinol metabolism (52)
- RNA degradation (51)
- Base excision repair (50)
- Tryptophan metabolism (50)
- ABC transporters (49)
- Citrate cycle (TCA cycle) (48)
- Graft-versus-host disease (48)
- Primary immunodeficiency (48)
- Ribosome (48)
- Allograft rejection (46)
- Glycerolipid metabolism (46)
- Nucleotide excision repair (46)
- Autoimmune thyroid disease (45)
- Butanoate metabolism (45)
- Glutathione metabolism (45)
- Inositol phosphate metabolism (45)
- Fructose and mannose metabolism (44)
- DNA replication (43)
- Proteasome (42)
- Maturity onset diabetes of the young (41)
- Taste transduction (41)
- Histidine metabolism (40)
- Cysteine and methionine metabolism (39)
- Starch and sucrose metabolism (39)
- Lysine degradation (38)
- Homologous recombination (36)
- Sphingolipid metabolism (35)
- Androgen and estrogen metabolism (34)
- Glycerophospholipid metabolism (34)
- Olfactory transduction (33)
- Propanoate metabolism (33)
- Renin-angiotensin system (33)
- Basal transcription factors (32)
- Mismatch repair (31)
- Drug metabolism - other enzymes (30)
- Amino sugar and nucleotide sugar metabolism (29)
- Porphyrin and chlorophyll metabolism (29)
- Glycine (28)
- Non-homologous end-joining (28)
- Phenylalanine metabolism (28)
- serine and threonine metabolism (28)
- Galactose metabolism (27)
- Nicotinate and nicotinamide metabolism (27)
- Nitrogen metabolism (27)
- SNARE interactions in vesicular transport (27)
- beta-Alanine metabolism (27)
- Pentose phosphate pathway (26)
- Biosynthesis of unsaturated fatty acids (24)
- Primary bile acid biosynthesis (23)
- Linoleic acid metabolism (22)
- Asthma (21)
- N-Glycan biosynthesis (21)
- Riboflavin metabolism (20)
- Ether lipid metabolism (19)
- Aminoacyl-tRNA biosynthesis (18)
- C21-Steroid hormone metabolism (18)
- Pentose and glucuronate interconversions (17)
- Terpenoid backbone biosynthesis (17)
- Folate biosynthesis (16)
- Limonene and pinene degradation (16)
- Ascorbate and aldarate metabolism (15)
- Glycosaminoglycan degradation (15)
- Glyoxylate and dicarboxylate metabolism (15)
- O-Glycan biosynthesis (14)
- Pantothenate and CoA biosynthesis (14)
- Taurine and hypotaurine metabolism (14)
- One carbon pool by folate (12)
- Other glycan degradation (12)
- Selenoamino acid metabolism (12)
- Synthesis and degradation of ketone bodies (11)
- Chondroitin sulfate biosynthesis (10)
- Circadian rhythm - mammal (10)
- Methane metabolism (10)
- D-Glutamine and D-glutamate metabolism (9)
- alpha-Linolenic acid metabolism (9)
- Glycosphingolipid biosynthesis - ganglio series (8)
- Glycosphingolipid biosynthesis - lacto and neolacto series (8)
- Steroid biosynthesis (8)
- leucine and isoleucine biosynthesis (8)
- Fatty acid biosynthesis (7)
- Heparan sulfate biosynthesis (7)
- Phenylalanine (7)
- tyrosine and tryptophan biosynthesis (7)
- Caffeine metabolism (6)
- Cyanoamino acid metabolism (6)
- Glycosphingolipid biosynthesis - globo series (6)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (6)
- Keratan sulfate biosynthesis (6)
- Sulfur metabolism (6)
- Fatty acid elongation in mitochondria (5)
- RNA polymerase (5)
- Vitamin B6 metabolism (5)
- Protein export (4)
- Thiamine metabolism (4)
- Lysine biosynthesis (3)
- O-Mannosyl glycan biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)