Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Alpha-tubulin antibody was raised against an 18 amino acid peptide near the amino terminus of human alpha-tubulin |
Rabbit Polyclonal TRPC6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6. |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Horse, Human, Monkey, Pig |
Conjugation | Unconjugated |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Rabbit Polyclonal Anti-TRPA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL |
Rabbit Polyclonal TRPC3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC3. |
Anti-TRPC3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit Polyclonal TRPC3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRPC3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC3. |
Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759) |
Rabbit Polyclonal TRPV4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRPV4 antibody was raised against an 18 amino acid peptide near the center of human TRPV4. The immunogen is located within amino acids 380 - 430 of TRPV4. |
Rabbit Polyclonal Anti-TRPM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK |
Rabbit polyclonal TRPM8 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8. |
Rabbit polyclonal TRPC5 Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-283 amino acids from the N-terminal region of human TRPC5. |
Rabbit polyclonal Anti-TRPV5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA |
Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |
Rabbit Polyclonal Anti-TRPV4 Antibody
Applications | IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR |
Rabbit Polyclonal Anti-TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the C terminal of human TRPC6. Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS |
TRPV4 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
Conjugation | Unconjugated |
Immunogen | TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%). |
Anti-TRPC3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 823-836 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Anti-TRPM7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPM7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPM5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5 |
Anti-TRPA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1105-1119 amino acids of human transient receptor potential cation channel, subfamily A, member 1 |
Anti-TRPC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 919-931 amino acids of human transient receptor potential cation channel, subfamily C, member 6 |
Anti-TRPC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 919-931 amino acids of human transient receptor potential cation channel, subfamily C, member 6 |
Anti-PKD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 956-968 amino acids of Human polycystic kidney disease 2 (autosomal dominant) |
Anti-TRPC7 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 42-351 amino acids of human transient receptor potential cation channel, subfamily C, member 7 |
Anti-TRPV4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Anti-TRPV4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Anti-TRPM1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 806-820 amino acids of human transient receptor potential cation channel, subfamily M, member 1 |
Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRPM8 |
Rabbit Polyclonal Anti-TRPM2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRPM2 |
Rabbit Polyclonal Anti-PKD2L1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PKD2L1 |
Rabbit Polyclonal Anti-TRPM7 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPM7 |
Rabbit Polyclonal Anti-TRPV1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPV1 |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPM3 |
Rabbit Polyclonal Anti-TRPM6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPM6 |
Rabbit Polyclonal Anti-TRPV5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPV5 |
Rabbit Polyclonal Anti-TRPV3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPV3 |