Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
.jpg?d=110x100 "User supplied image")
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal TET1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human TET1 protein (between residues 1700 to 1800) [UniProt Q8NFU7] |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Active filters
Reactivities
- Mouse
Applications
- IHC
Conjugates
- Unconjugated
Filter by
Target Symbol
- MAP2K1 (111)
- NME1 (84)
- OTC (73)
- ERBB2 (72)
- AKT1 (60)
- MAP2K3 (60)
- ABCB1 (53)
- JUN (52)
- LGALS3 (52)
- CTNNB1 (51)
- PCNA (51)
- ERCC1 (48)
- APP (46)
- VSNL1 (46)
- PIK3C2A (44)
- TOP2A (44)
- BCL2 (40)
- NCAM1 (40)
- SENP2 (39)
- ABAT (37)
- LOX (37)
- MEF2C (37)
- BBOX1 (36)
- AGR2 (35)
- MCM2 (35)
- ESR1 (34)
- HSPD1 (34)
- SQSTM1 (34)
- BTK (33)
- PFKP (33)
- PIK3CG (33)
- VBP1 (33)
- AKR1A1 (32)
- F13A1 (32)
- LTA4H (32)
- MTOR (32)
- POR (32)
- PPP5C (32)
- SYP (32)
- TYMS (32)
- UBE2G2 (32)
- LPIN1 (31)
- NR3C1 (31)
- ALDH1L1 (30)
- KRT18 (30)
- NPR3 (30)
- PARVA (30)
- PTPRE (30)
- STAT4 (30)
- EGFR (29)
- FOS (29)
- GCH1 (29)
- MMP13 (29)
- TLE1 (29)
- ACAT2 (28)
- GFAP (28)
- GLI1 (28)
- L1CAM (28)
- UNG (28)
- VIM (28)
- ACAA2 (27)
- DEF6 (27)
- HADH (27)
- MAPK1 (27)
- PDSS2 (27)
- SNAP25 (27)
- CRYAB (26)
- DNM1L (26)
- DSTN (26)
- ERG (25)
- FBXO21 (25)
- POU2AF1 (25)
- PRKAR2A (25)
- RAB21 (25)
- SCFD1 (25)
- TNNT2 (25)
- TSC22D1 (25)
- EPN2 (24)
- PSMA6 (24)
- RHOJ (24)
- RRM1 (24)
- SRR (24)
- STAT5A (24)
- TH (24)
- TTLL12 (24)
- UPRT (24)
- USP7 (24)
- BCL10 (23)
- BRAF (23)
- CHEK2 (23)
- CMPK1 (23)
- FMR1 (23)
- GADD45G (23)
- GPR17 (23)
- HSPA1A (23)
- KRT5 (23)
- KRT8 (23)
- NKX2-1 (23)
- NRBP1 (23)
- PIM2 (23)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
- Unmodified (2232)
- Phospho-specific (377)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (16)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K5 (2)
- Phospho S127 (2)
- Phospho S39 (2)
- Phospho S727 (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (2)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (2)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- Pan DiMethyl-lysine (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S104 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S157 (1)
- Phospho S182 (1)
- Phospho S240/244 (1)
- Phospho S243 (1)
- Phospho S280 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S37 (1)
- Phospho S376 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S455 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S5 (1)
- Phospho S51 (1)
- Phospho S529 (1)
- Phospho S612 (1)
- Phospho S62 (1)
- Phospho S73 (1)
- Phospho S795 (1)
- Phospho S80 (1)
- Phospho S89 (1)
- Phospho S957 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T17 (1)
- Phospho T179 (1)
- Phospho T18/S19 (1)
- Phospho T183/T172 (1)
- Phospho T1989 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T286 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T37/46 (1)
- Phospho T389 (1)
- Phospho T45 (1)
- Phospho T58 (1)
- Phospho T6 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T70 (1)
- Phospho T91 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1217 (1)
- Phospho Y15 (1)
- Phospho Y182 (1)
- Phospho Y207 (1)
- Phospho Y245 (1)
- Phospho Y412 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created to reduce immunogenicity during in vivo applications. (1)
Assay Types
Families
- Druggable Genome (11470)
- Transmembrane (3312)
- Transcription Factors (2794)
- Protein Kinase (1602)
- ES Cell Differentiation/IPS (1266)
- Secreted Protein (1161)
- Stem cell - Pluripotency (907)
- Protease (798)
- GPCR (310)
- Adult stem cells (251)
- Nuclear Hormone Receptor (200)
- Phosphatase (191)
- Embryonic stem cells (180)
- Cancer stem cells (163)
- Stem cell relevant signaling - JAK/STAT signaling pathway (132)
- Induced pluripotent stem cells (105)
- Stem cell relevant signaling - DSL/Notch pathway (98)
- Ion Channels: Other (87)
- P450 (74)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (69)
- Ion Channels: Potassium (60)
- Ion Channels: Transient receptor potential (45)
- Stem cell relevant signaling - Wnt Signaling pathway (45)
- Ion Channels: Cys-loop Receptors (32)
- Ion Channels: Glutamate Receptors (30)
- Ion Channels: Sodium (19)
- Ion Channels: Cyclic nucleotide gated (10)
- Ion Channels: Calcium (4)
- Ion Channels: ATP Receptors (2)
Pathways
- Metabolic pathways (2045)
- Pathways in cancer (1650)
- MAPK signaling pathway (1063)
- Focal adhesion (1025)
- Prostate cancer (793)
- Neurotrophin signaling pathway (766)
- Colorectal cancer (759)
- ErbB signaling pathway (749)
- Insulin signaling pathway (685)
- Regulation of actin cytoskeleton (673)
- Toll-like receptor signaling pathway (648)
- Pancreatic cancer (643)
- T cell receptor signaling pathway (630)
- Chemokine signaling pathway (612)
- Endometrial cancer (607)
- Chronic myeloid leukemia (591)
- B cell receptor signaling pathway (583)
- Acute myeloid leukemia (556)
- Renal cell carcinoma (551)
- Non-small cell lung cancer (550)
- Progesterone-mediated oocyte maturation (545)
- Fc epsilon RI signaling pathway (536)
- Glioma (522)
- Melanoma (521)
- Fc gamma R-mediated phagocytosis (485)
- Apoptosis (467)
- Wnt signaling pathway (463)
- GnRH signaling pathway (457)
- Small cell lung cancer (454)
- VEGF signaling pathway (453)
- Cell cycle (436)
- Endocytosis (417)
- Natural killer cell mediated cytotoxicity (417)
- Bladder cancer (415)
- Alzheimer's disease (412)
- Jak-STAT signaling pathway (400)
- Leukocyte transendothelial migration (398)
- Gap junction (377)
- Melanogenesis (372)
- Oocyte meiosis (366)
- Adherens junction (362)
- mTOR signaling pathway (356)
- Calcium signaling pathway (354)
- Purine metabolism (340)
- Cytokine-cytokine receptor interaction (320)
- Neuroactive ligand-receptor interaction (314)
- Vascular smooth muscle contraction (313)
- Adipocytokine signaling pathway (312)
- Huntington's disease (311)
- Tight junction (298)
- Long-term potentiation (297)
- Axon guidance (292)
- Amyotrophic lateral sclerosis (ALS) (287)
- Thyroid cancer (286)
- Ubiquitin mediated proteolysis (286)
- Pyrimidine metabolism (284)
- Type II diabetes mellitus (283)
- Long-term depression (274)
- Epithelial cell signaling in Helicobacter pylori infection (269)
- Parkinson's disease (265)
- Glycolysis / Gluconeogenesis (259)
- Prion diseases (253)
- Pathogenic Escherichia coli infection (243)
- TGF-beta signaling pathway (241)
- p53 signaling pathway (239)
- Arginine and proline metabolism (227)
- Cell adhesion molecules (CAMs) (211)
- Basal cell carcinoma (201)
- Nucleotide excision repair (198)
- Valine (198)
- Dorso-ventral axis formation (196)
- Phosphatidylinositol signaling system (195)
- leucine and isoleucine degradation (193)
- Dilated cardiomyopathy (191)
- NOD-like receptor signaling pathway (183)
- Hypertrophic cardiomyopathy (HCM) (182)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (171)
- RIG-I-like receptor signaling pathway (165)
- Inositol phosphate metabolism (159)
- DNA replication (154)
- Fatty acid metabolism (153)
- Oxidative phosphorylation (148)
- RNA degradation (147)
- Hedgehog signaling pathway (145)
- Butanoate metabolism (144)
- Alanine (142)
- aspartate and glutamate metabolism (142)
- Base excision repair (141)
- Spliceosome (141)
- Mismatch repair (139)
- Notch signaling pathway (129)
- PPAR signaling pathway (125)
- Propanoate metabolism (125)
- Lysine degradation (124)
- Pyruvate metabolism (124)
- Tyrosine metabolism (124)
- Antigen processing and presentation (122)
- Lysosome (115)
- Proteasome (114)
- Primary immunodeficiency (113)
- Cardiac muscle contraction (111)
- ABC transporters (109)
- Tryptophan metabolism (108)
- ECM-receptor interaction (107)
- Cytosolic DNA-sensing pathway (99)
- Glycine (96)
- Hematopoietic cell lineage (96)
- serine and threonine metabolism (96)
- Arachidonic acid metabolism (95)
- Complement and coagulation cascades (94)
- Viral myocarditis (94)
- Vibrio cholerae infection (93)
- Drug metabolism - cytochrome P450 (92)
- Glutathione metabolism (92)
- Glycerolipid metabolism (89)
- beta-Alanine metabolism (88)
- Systemic lupus erythematosus (87)
- One carbon pool by folate (86)
- Citrate cycle (TCA cycle) (84)
- Histidine metabolism (83)
- Pentose phosphate pathway (83)
- Metabolism of xenobiotics by cytochrome P450 (81)
- Regulation of autophagy (78)
- Retinol metabolism (75)
- Starch and sucrose metabolism (75)
- Type I diabetes mellitus (75)
- Cysteine and methionine metabolism (71)
- Fructose and mannose metabolism (67)
- Maturity onset diabetes of the young (66)
- Amino sugar and nucleotide sugar metabolism (65)
- Ribosome (62)
- Terpenoid backbone biosynthesis (62)
- Renin-angiotensin system (60)
- Fatty acid elongation in mitochondria (58)
- Galactose metabolism (58)
- SNARE interactions in vesicular transport (54)
- Nicotinate and nicotinamide metabolism (50)
- Nitrogen metabolism (47)
- N-Glycan biosynthesis (46)
- Homologous recombination (45)
- Circadian rhythm - mammal (44)
- Porphyrin and chlorophyll metabolism (44)
- Folate biosynthesis (43)
- Synthesis and degradation of ketone bodies (40)
- Sphingolipid metabolism (39)
- Phenylalanine metabolism (36)
- Glycerophospholipid metabolism (35)
- Methane metabolism (35)
- Glyoxylate and dicarboxylate metabolism (34)
- Selenoamino acid metabolism (33)
- Taste transduction (32)
- Primary bile acid biosynthesis (31)
- RNA polymerase (31)
- Drug metabolism - other enzymes (30)
- Olfactory transduction (30)
- Androgen and estrogen metabolism (29)
- Aminoacyl-tRNA biosynthesis (28)
- Non-homologous end-joining (24)
- Autoimmune thyroid disease (23)
- Graft-versus-host disease (23)
- Allograft rejection (22)
- Other glycan degradation (22)
- Pantothenate and CoA biosynthesis (22)
- Taurine and hypotaurine metabolism (22)
- Ether lipid metabolism (21)
- Sulfur metabolism (21)
- Ascorbate and aldarate metabolism (18)
- Caffeine metabolism (18)
- Fatty acid biosynthesis (18)
- Basal transcription factors (17)
- Biosynthesis of unsaturated fatty acids (15)
- Glycosaminoglycan degradation (15)
- Riboflavin metabolism (15)
- Vitamin B6 metabolism (15)
- Linoleic acid metabolism (14)
- O-Glycan biosynthesis (14)
- Limonene and pinene degradation (13)
- Steroid biosynthesis (13)
- Cyanoamino acid metabolism (12)
- D-Glutamine and D-glutamate metabolism (11)
- leucine and isoleucine biosynthesis (11)
- Glycosphingolipid biosynthesis - lacto and neolacto series (10)
- Asthma (8)
- Chondroitin sulfate biosynthesis (8)
- Thiamine metabolism (8)
- Heparan sulfate biosynthesis (7)
- Pentose and glucuronate interconversions (7)
- alpha-Linolenic acid metabolism (7)
- Keratan sulfate biosynthesis (6)
- Protein export (5)
- C21-Steroid hormone metabolism (4)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (4)
- Phenylalanine (4)
- tyrosine and tryptophan biosynthesis (4)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Glycosphingolipid biosynthesis - globo series (2)
- Lysine biosynthesis (2)
- O-Mannosyl glycan biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)