Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
CD34 mouse monoclonal antibody, clone QBEnd-10, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human, Primate |
CD38 mouse monoclonal antibody, clone T16, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Antibody against NANOG (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 94-123 amino acids from the Central region of human NANOG. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
SMAD3 mouse monoclonal antibody, clone AF9F7, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Antibody against WIF1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1. |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Smad1 (Ser465) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP) |
| Modifications | Phospho-specific |
Active filters
Applications
- IHC
Families
- Cancer stem cells
Filter by
Category
Target Symbol
- EGFR (59)
- CD44 (47)
- GLI1 (40)
- CD34 (34)
- SMAD1 (27)
- HES1 (25)
- NOTCH1 (23)
- CD38 (13)
- SMAD3 (12)
- GLI2 (11)
- POU5F1 (10)
- SOX2 (9)
- BMP4 (6)
- SFRP1 (6)
- SMAD2 (6)
- SMAD6 (6)
- WNT3A (6)
- NANOG (5)
- WNT1 (5)
- DKK1 (4)
- BMP15 (3)
- BMP2 (3)
- BMP7 (3)
- DLL4 (3)
- GDF9 (3)
- GLI3 (3)
- SMAD5 (3)
- WNT2 (3)
- WNT5A (3)
- WNT6 (3)
- WNT8A (3)
- BMP5 (2)
- BMP6 (2)
- DLL3 (2)
- GDF3 (2)
- WIF1 (2)
- WNT8B (2)
- BMP8B (1)
- DKK2 (1)
- DKK4 (1)
- GDF5 (1)
- NODAL (1)
- SFRP4 (1)
- WNT7B (1)
Reactivities
- Human (333)
- Mouse (211)
- Rat (176)
- Dog (21)
- Monkey (16)
- Bovine (10)
- Chicken (10)
- Pig (5)
- Primate (5)
- Xenopus (5)
- Bat (4)
- Zebrafish (4)
- Gibbon (3)
- Gorilla (3)
- Horse (3)
- Rabbit (3)
- Cow (2)
- Hamster (2)
- Sheep (2)
- X. tropicalis (2)
- Canine (1)
- Canis (1)
- Chimpanzee (1)
- Feline (1)
- Guinea Pig (1)
- Porcine (1)
- Quail (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (166)
- Hedgehog signaling pathway (97)
- Hematopoietic cell lineage (97)
- Basal cell carcinoma (89)
- Dorso-ventral axis formation (82)
- Adherens junction (77)
- Colorectal cancer (77)
- Pancreatic cancer (77)
- TGF-beta signaling pathway (73)
- Calcium signaling pathway (72)
- Cytokine-cytokine receptor interaction (66)
- Endocytosis (62)
- Bladder cancer (59)
- Endometrial cancer (59)
- Epithelial cell signaling in Helicobacter pylori infection (59)
- ErbB signaling pathway (59)
- Focal adhesion (59)
- Gap junction (59)
- Glioma (59)
- GnRH signaling pathway (59)
- MAPK signaling pathway (59)
- Melanoma (59)
- Non-small cell lung cancer (59)
- Prostate cancer (59)
- Regulation of actin cytoskeleton (59)
- Wnt signaling pathway (59)
- Notch signaling pathway (53)
- ECM-receptor interaction (47)
- Cell adhesion molecules (CAMs) (34)
- Melanogenesis (29)
- Maturity onset diabetes of the young (25)
- Prion diseases (23)
- Cell cycle (18)
- Metabolic pathways (13)
- Nicotinate and nicotinamide metabolism (13)
- Chronic myeloid leukemia (12)
- Acute myeloid leukemia (3)