CREB1 mouse monoclonal antibody, clone 3F1-1B2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
CREB1 mouse monoclonal antibody, clone 3F1-1B2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
c Kit (KIT) (41-140) mouse monoclonal antibody, clone 5F6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
EP300 mouse monoclonal antibody, clone 1B1, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
CAMK2A pThr286 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Xenopus |
Immunogen | Phosphopeptide corresponding to amino acid residues surrounding the phosphoThr286 found in Rat brain CaM Kinase II. |
ADCY5 (+ADCY6) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 1111-1160 of Human ADCY 5. |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Mouse, Porcine, Rat, Xenopus, Zebrafish |
Immunogen | Synthetic peptide from an internal region of human WNT3 |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Xenopus |
Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
KAT3A / CBP (CREBBP) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
Endothelin 1 (EDN1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 111-138 amino acids from the Central region of human EDN1 |
SCF (KITLG) mouse monoclonal antibody, clone hKL12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Primate |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hSCF (anti-hSCF). |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hSCF. |
Mouse Monoclonal anti-CAMK2A Antibody
Applications | IHC |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1. |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-P300/CBP antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human P300/CBP. |
Rabbit polyclonal anti-PRKX antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKX. |
GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta. |
GNAS Rabbit Polyclonal (aa385-394) Antibody
Applications | IHC |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Rabbit polyclonal DVL1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit Polyclonal CREB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB. |
Rabbit polyclonal RASH/RASK/RASN antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human RASH/RASK/RASN antibody. |
Rabbit Polyclonal Anti-Melanocortin Receptor 1
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HAQGIARLHKRQRPVH, corresponding to amino acid residues 217-232 of human MC1R. 3rd intracellular loop. |
Rabbit Polyclonal Anti-TYRP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
Rabbit Polyclonal Anti-WNT10B Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR |
Rabbit Polyclonal Anti-FZD5 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT |
CAMK2B mouse monoclonal antibody, clone S11, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
Applications | IF, IHC, WB |
Reactivities | Chicken, Human, Rat |
USD 480.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) mouse monoclonal antibody, clone 2B8-2A5
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 805.00
2 Weeks
Endothelin 1 (EDN1) (C-term) mouse monoclonal antibody, clone 1C4, Purified
Applications | ELISA, IHC, R |
Reactivities | Human |
CREB1 mouse monoclonal antibody, clone 5F2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c Kit (KIT) (41-140) mouse monoclonal antibody, clone 6G12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone 4F7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone X1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Endothelin 1 (EDN1) sheep polyclonal antibody, Purified
Applications | ELISA, IHC, R |
Reactivities | Human |
Immunogen | Human Endothelin, KLH conjugated |
MEK2 (MAP2K2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 300-350 of Human MEF-2. |
CAMK2G (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Immunogen | KLH conjugated synthetic peptide between 309-338 amino acids from the C-terminal region of Human CAMK2G (CAMK2 gamma). |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit. |
KAT3A / CBP (CREBBP) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MEK1 (MAP2K1) pThr292 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
CREB1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction
Applications | ELISA, IHC, WB |
Reactivities | Drosophila, Mouse |
Immunogen | Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule |
GSK3 beta (GSK3B) rabbit polyclonal antibody, Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | GSK3B antibody was raised against synthetic peptide |
SCF (KITLG) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Endothelin 1 (EDN1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 183-211 amino acids from the C-terminal region of Human EDN1 |
Goat Polyclonal Antibody against POMC
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NAIIKNAYKKGE, from the C Terminus of the protein sequence according to NP_000930.1; NP_001030333.1. |