Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ANK3 / ANKYRIN-G Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | ANK3 / ANKYRIN-G antibody was raised against synthetic peptide C-SWQNETSSGNLE from an internal region of human ANK3 (NP_066267.2; NP_001140.2). Percent identity by BLAST analysis: Human, Gorilla, Monkey, Pig (100%); Orangutan, Gibbon, Elephant, Panda, Bovine, Dog, Horse (92%); Hamster, Bat, Rabbit (83%). |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2). |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
TEK (C-term ) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TEK (TIE2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 758-789 amino acids from the C-terminal region of human TEK (TIE2). |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Drosophila, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit Polyclonal antibody to SPR (sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 65 and 261 of SPR (Uniprot ID#P35270) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit Polyclonal antibody to STK25 (serine/threonine kinase 25 (STE20 homolog, yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 231 of STK25 (Uniprot ID#O00506) |
Rabbit Polyclonal antibody to RAMP2 (receptor (G protein-coupled) activity modifying protein 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 111 and 175 of RAMP2 (Uniprot ID#O60895) |
Rabbit Polyclonal antibody to EEF2K (eukaryotic elongation factor-2 kinase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 268 of EEF2K (Uniprot ID#O00418) |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589) |
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit Polyclonal antibody to Collagen III alpha1 (collagen, type III, alpha 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1247 and 1389 of Collagen III alpha1 |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal antibody to alpha Tubulin (tubulin, alpha 1b)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 118 and 365 of alpha Tubulin (Uniprot ID#P68363) |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit polyclonal ARRB1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARRB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-363 amino acids from the C-terminal region of human ARRB1. |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Rabbit polyclonal SCAP Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 604-632 amino acids from the Central region of human SCAP. |
Rabbit polyclonal EXT2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2. |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Antibody against GNB2L1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1. |
Rabbit Polyclonal Antibody against RPS6KB1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This S6K (RPS6KB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-306 amino acids from the Central region of human S6K (RPS6KB1). |
Rabbit Polyclonal antibody to CSE1L (CSE1 chromosome segregation 1-like (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 222 and 469 of CSE1L (Uniprot ID#P55060) |
Rabbit Polyclonal antibody to 14-3-3 beta (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 171 of 14-3-3 beta (Uniprot ID#P31946) |
Rabbit polyclonal antibody to Scaffold attachment factor B1 (scaffold attachment factor B)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 476 and 695 of SAFB (Uniprot ID#Q15424) |
Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531) |
Active filters
Reactivities
- Bovine
Applications
- IHC
Families
- Druggable Genome
Filter by
Category
Target Symbol
- GLG1 (3)
- GNAS (3)
- GPR4 (3)
- HSPD1 (3)
- TUBA1A (3)
- ADRA1B (2)
- ARNT (2)
- ASPA (2)
- CANX (2)
- DCX (2)
- EPHX1 (2)
- ERP44 (2)
- FASN (2)
- GALR2 (2)
- GPR137B (2)
- GRPR (2)
- H2AFZ (2)
- HPRT1 (2)
- HSP90AB1 (2)
- HTR1F (2)
- ITGA2 (2)
- JUN (2)
- KCNJ6 (2)
- KCNMA1 (2)
- LGR5 (2)
- MAPK1 (2)
- OGT (2)
- PIK3R1 (2)
- PSMA7 (2)
- PTGES (2)
- RPS6KB1 (2)
- RXFP3 (2)
- SMAD3 (2)
- TUBB (2)
- UBE2S (2)
- UNC13B (2)
- WNT4 (2)
- ABCA4 (1)
- ACKR3 (1)
- ACKR4 (1)
- ACTN4 (1)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ADAP1 (1)
- ADGRG1 (1)
- ADGRL3 (1)
- ADGRL4 (1)
- ADRA1A (1)
- AGTR2 (1)
- AHCYL2 (1)
- AIF1 (1)
- AIFM1 (1)
- AK4 (1)
- ALPI (1)
- ALPL (1)
- AMPD1 (1)
- ANK3 (1)
- ANXA1 (1)
- AP2M1 (1)
- APP (1)
- ARAF (1)
- ARRB1 (1)
- ARRB2 (1)
- ASB4 (1)
- ATG5 (1)
- ATP6V1B1 (1)
- ATXN3 (1)
- AVPR1B (1)
- BCL2L2 (1)
- BMP10 (1)
- CALCRL (1)
- CAMK2A (1)
- CAPN5 (1)
- CASP6 (1)
- CAT (1)
- CAV2 (1)
- CCKAR (1)
- CCNT2 (1)
- CCR1 (1)
- CD36 (1)
- CDC2 (1)
- CDK1 (1)
- CENPU (1)
- CFL2 (1)
- CHRM3 (1)
- CHRNA3 (1)
- CKB (1)
- CLIC3 (1)
- CNGA2 (1)
- CNOT4 (1)
- COL3A1 (1)
- CSE1L (1)
- CSNK2A1 (1)
- CTNNA1 (1)
- CTNNAL1 (1)
- CTNNB1 (1)
- CXCR5 (1)
- DCTN1 (1)
- DDB1 (1)
- DDR1 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (41)
- Metabolic pathways (37)
- Neuroactive ligand-receptor interaction (35)
- Focal adhesion (22)
- MAPK signaling pathway (22)
- Calcium signaling pathway (20)
- Wnt signaling pathway (20)
- Gap junction (19)
- Regulation of actin cytoskeleton (19)
- Progesterone-mediated oocyte maturation (18)
- Vascular smooth muscle contraction (17)
- Chemokine signaling pathway (16)
- Insulin signaling pathway (16)
- Adherens junction (15)
- Colorectal cancer (14)
- ErbB signaling pathway (14)
- Prostate cancer (14)
- Renal cell carcinoma (14)
- Acute myeloid leukemia (13)
- Cell cycle (13)
- GnRH signaling pathway (13)
- Melanogenesis (13)
- Oocyte meiosis (13)
- Chronic myeloid leukemia (12)
- Neurotrophin signaling pathway (12)
- Pancreatic cancer (12)
- T cell receptor signaling pathway (12)
- B cell receptor signaling pathway (11)
- Natural killer cell mediated cytotoxicity (11)
- Pathogenic Escherichia coli infection (11)
- Purine metabolism (11)
- VEGF signaling pathway (11)
- Endocytosis (10)
- Fc epsilon RI signaling pathway (10)
- Fc gamma R-mediated phagocytosis (10)
- TGF-beta signaling pathway (10)
- Toll-like receptor signaling pathway (10)
- Endometrial cancer (9)
- Leukocyte transendothelial migration (9)
- Long-term depression (9)
- Small cell lung cancer (9)
- mTOR signaling pathway (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Axon guidance (8)
- Glioma (8)
- Long-term potentiation (8)
- NOD-like receptor signaling pathway (8)
- Non-small cell lung cancer (8)
- Bladder cancer (7)
- Dilated cardiomyopathy (7)
- Jak-STAT signaling pathway (7)
- Tight junction (7)
- Apoptosis (6)
- Cytokine-cytokine receptor interaction (6)
- ECM-receptor interaction (6)
- Melanoma (6)
- Proteasome (6)
- Type II diabetes mellitus (6)
- Alzheimer's disease (5)
- Antigen processing and presentation (5)
- Basal cell carcinoma (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Hematopoietic cell lineage (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- RNA degradation (5)
- Taste transduction (5)
- Thyroid cancer (5)
- Ubiquitin mediated proteolysis (5)
- Vibrio cholerae infection (5)
- Adipocytokine signaling pathway (4)
- Arachidonic acid metabolism (4)
- Arginine and proline metabolism (4)
- Cell adhesion molecules (CAMs) (4)
- Folate biosynthesis (4)
- Hedgehog signaling pathway (4)
- Huntington's disease (4)
- Metabolism of xenobiotics by cytochrome P450 (4)
- Nucleotide excision repair (4)
- Olfactory transduction (4)
- Phosphatidylinositol signaling system (4)
- RIG-I-like receptor signaling pathway (4)
- Systemic lupus erythematosus (4)
- Type I diabetes mellitus (4)
- p53 signaling pathway (4)
- Alanine (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- Complement and coagulation cascades (3)
- DNA replication (3)
- Dorso-ventral axis formation (3)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Glutathione metabolism (3)
- Histidine metabolism (3)
- Maturity onset diabetes of the young (3)
- Mismatch repair (3)
- Prion diseases (3)
- Regulation of autophagy (3)
- aspartate and glutamate metabolism (3)
- Base excision repair (2)
- Cytosolic DNA-sensing pathway (2)
- Fatty acid biosynthesis (2)
- Fructose and mannose metabolism (2)
- Glycine (2)
- Glycolysis / Gluconeogenesis (2)
- Homologous recombination (2)
- Inositol phosphate metabolism (2)
- Lysosome (2)
- Notch signaling pathway (2)
- O-Glycan biosynthesis (2)
- Parkinson's disease (2)
- Pentose phosphate pathway (2)
- Ribosome (2)
- Tryptophan metabolism (2)
- Valine (2)
- Viral myocarditis (2)
- serine and threonine metabolism (2)
- ABC transporters (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Aminoacyl-tRNA biosynthesis (1)
- Basal transcription factors (1)
- Citrate cycle (TCA cycle) (1)
- Cysteine and methionine metabolism (1)
- D-Glutamine and D-glutamate metabolism (1)
- Ether lipid metabolism (1)
- Galactose metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Heparan sulfate biosynthesis (1)
- Linoleic acid metabolism (1)
- Methane metabolism (1)
- N-Glycan biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- Nitrogen metabolism (1)
- Non-homologous end-joining (1)
- Other glycan degradation (1)
- Oxidative phosphorylation (1)
- PPAR signaling pathway (1)
- Pantothenate and CoA biosynthesis (1)
- Phenylalanine metabolism (1)
- Primary immunodeficiency (1)
- Propanoate metabolism (1)
- Pyrimidine metabolism (1)
- Pyruvate metabolism (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)
- Riboflavin metabolism (1)
- Selenoamino acid metabolism (1)
- Sphingolipid metabolism (1)
- Spliceosome (1)
- Starch and sucrose metabolism (1)
- Sulfur metabolism (1)
- Tyrosine metabolism (1)
- alpha-Linolenic acid metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)