Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal XIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP. |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit Polyclonal cIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | c-IAP antibody was raised against a synthetic peptide corresponding to 14 amino acids at the C-terminus of human c-IAP1 c-IAP antibody detects both c-IAP1 and c-IAP2. |
Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531) |
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
SIAH1 (+SIAH2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
SOCS1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human SOCS1 |
Active filters
Applications
- IHC
Families
- Druggable Genome
Pathways
- Ubiquitin mediated proteolysis
Filter by
Category
Target Symbol
- UBE2G2 (50)
- MDM2 (48)
- FBXW7 (28)
- SOCS3 (27)
- ANAPC11 (25)
- BRCA1 (24)
- ERCC8 (18)
- UBOX5 (10)
- SMURF2 (8)
- VHL (7)
- ANAPC1 (6)
- ANAPC2 (6)
- CDC16 (6)
- PIAS1 (6)
- UBA7 (6)
- BIRC6 (5)
- SIAH1 (5)
- TRAF6 (5)
- UBE3B (5)
- BIRC2 (4)
- CDC27 (4)
- CUL1 (4)
- CUL3 (4)
- SOCS1 (4)
- STUB1 (4)
- UBE2S (4)
- UBR5 (4)
- XIAP (4)
- AIRE (3)
- ANAPC10 (3)
- ANAPC4 (3)
- ANAPC5 (3)
- CBL (3)
- CDC20 (3)
- CUL2 (3)
- DDB1 (3)
- PML (3)
- SKP1 (3)
- SKP2 (3)
- SMURF1 (3)
- UBE2N (3)
- ANAPC7 (2)
- BIRC3 (2)
- CUL5 (2)
- PRPF19 (2)
- SYVN1 (2)
- BTRC (1)
- CBLC (1)
- CDC23 (1)
- ELOB (1)
- ELOC (1)
- FBXO2 (1)
- FBXW11 (1)
- FBXW8 (1)
- FZR1 (1)
- ITCH (1)
- MAP3K1 (1)
- MID1 (1)
- NEDD4 (1)
- NEDD4L (1)
- RBX1 (1)
- RCHY1 (1)
- RNF7 (1)
- TRIM37 (1)
- TTK (1)
- UBE2B (1)
- UBE2C (1)
- UBE2K (1)
- WWP2 (1)