Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal FRS2 (Tyr436) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FRS2 around the phosphorylation site of tyrosine 436 (L-N-YP-I-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal FRS2 (Tyr436) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human FRS2 around the phosphorylation site of Tyrosine 436. |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal RIPK2 (Ab-176) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit Polyclonal Anti-ABL1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABL1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Isotypes
- IgG
Pathways
- Neurotrophin signaling pathway
Filter by
Target Symbol
- AKT1 (22)
- BAD (13)
- RELA (13)
- TP53 (13)
- BAX (10)
- IRS1 (10)
- JUN (10)
- BCL2 (9)
- NFKBIA (9)
- BRAF (8)
- BDNF (7)
- GSK3B (6)
- MAPK14 (6)
- FASLG (5)
- FOXO3 (5)
- NFKB1 (5)
- NTRK1 (5)
- PRKCD (5)
- RAF1 (5)
- TP73 (5)
- AKT3 (4)
- ATF4 (4)
- IKBKB (4)
- IRAK1 (4)
- MAPK1 (4)
- MAPKAPK2 (4)
- NFKBIB (4)
- NFKBIE (4)
- NGF (4)
- NTRK2 (4)
- PTPN11 (4)
- RPS6KA1 (4)
- SHC1 (4)
- YWHAB (4)
- YWHAZ (4)
- ABL1 (3)
- AKT2 (3)
- CAMK2A (3)
- CAMK2B (3)
- CAMK4 (3)
- IRS2 (3)
- MAGED1 (3)
- MAP2K2 (3)
- MAP3K5 (3)
- MAPK8 (3)
- NRAS (3)
- PIK3CD (3)
- TRAF6 (3)
- YWHAE (3)
- YWHAG (3)
- YWHAQ (3)
- BEX3 (2)
- FRS2 (2)
- GRB2 (2)
- HRAS (2)
- IRAK3 (2)
- MAP2K1 (2)
- MAPK3 (2)
- MAPK7 (2)
- MAPK9 (2)
- NGFR (2)
- PIK3CG (2)
- PIK3R1 (2)
- PIK3R3 (2)
- PLCG1 (2)
- PSEN1 (2)
- RAP1A (2)
- RAP1B (2)
- RIPK2 (2)
- RPS6KA2 (2)
- RPS6KA5 (2)
- RPS6KA6 (2)
- ARHGDIA (1)
- CALM1 (1)
- CALM2 (1)
- CALML5 (1)
- CDC42 (1)
- CRK (1)
- CRKL (1)
- GAB1 (1)
- IRAK4 (1)
- IRS4 (1)
- KIDINS220 (1)
- MAP2K5 (1)
- MAP2K7 (1)
- MAP3K1 (1)
- MAPK10 (1)
- MAPK11 (1)
- MAPK12 (1)
- MAPK13 (1)
- NTF3 (1)
- NTF4 (1)
- PIK3CA (1)
- PIK3CB (1)
- PIK3R2 (1)
- PIK3R5 (1)
- PLCG2 (1)
- RAC1 (1)
- RPS6KA3 (1)
- SH2B1 (1)