Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |
USD 480.00
2 Weeks
USD 480.00
2 Weeks
USD 480.00
2 Weeks
NSE (ENO2) mouse monoclonal antibody, clone NSE-P2, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
PFKL rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
GAPDH rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mammalian, Mouse, Rat |
| Immunogen | Purified recombinant human GAPDH |
NSE (ENO2) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Chickens were immunized with two synthetic peptide KLH conjugates corresponding to different regions of the NSE-2 gene product, but are shared between the Human (NP_001966, NCBI) and Rat (AAA41119) sequences. Production: After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.2 mg/ml. Finally, equal volumes of each of these affinity-purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613) |
Rabbit Polyclonal antibody to Pyruvate Dehydrogenase E1 alpha (pyruvate dehydrogenase (lipoamide) alpha 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 325 of (Uniprot ID#P08559) |
Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2). |
Rabbit polyclonal ADH4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4. |
Rabbit polyclonal Aldolase (ALDOA) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aldolase (ALDOA) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human Aldolase (ALDOA). |
Rabbit polyclonal GAPDH Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-91 amino acids from the N-terminal region of human GAPDH. |
Rabbit polyclonal PFKL Antibody (C-term L684)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL. |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residues 150 and 200 of human GAPDH using the numbering given in entry NP_002037.2 (GeneID 2597). |
Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338] |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG |
Rabbit Polyclonal Anti-ADH4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV |
Rabbit Polyclonal Anti-ADH4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-HK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG |
Active filters
Applications
- IHC
Pathways
- Glycolysis / Gluconeogenesis
Filter by
Category
Target Symbol
- PFKP (51)
- AKR1A1 (50)
- GPI (30)
- ADH1B (29)
- DLD (26)
- GAPDH (25)
- LDHA (25)
- ACSS2 (20)
- ALDH1A3 (20)
- ENO2 (20)
- ADH5 (16)
- PGAM2 (16)
- ALDH3A1 (15)
- PGAM4 (15)
- ALDOB (13)
- ADH7 (11)
- ALDH7A1 (10)
- ENO1 (10)
- GALM (10)
- ALDH3A2 (9)
- GCK (9)
- G6PC1 (6)
- PKM (6)
- ADH4 (5)
- PFKL (5)
- ALDH2 (4)
- ALDOA (4)
- HK2 (4)
- PCK1 (4)
- ALDH3B1 (3)
- ALDH9A1 (3)
- ENO3 (3)
- PDHA1 (3)
- ADH1A (2)
- DLAT (2)
- FBP1 (2)
- HK1 (2)
- LDHB (2)
- PGK1 (2)
- PKLR (2)
- ADH6 (1)
- ALDH3B2 (1)
- ALDOC (1)
- FBP2 (1)
- G6PC (1)
- HK3 (1)
- PCK2 (1)
- PDHA2 (1)
- PGAM1 (1)
- PGK2 (1)
- TPI1 (1)