Germany
Japan
United Kingdom
China
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Antibodies
DownloadRabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
CD11b (ITGAM) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to a sequence shared between the Mouse (NP_001076429.1) and Human gene products (NP_001139280.1). After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
USD 340.00
2 Weeks
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit polyclonal FGFR4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4. |
Active filters
Applications
- IHC
Pathways
- Regulation of actin cytoskeleton
Filter by
Target Symbol
- MAP2K1 (183)
- EGFR (59)
- PIK3CG (54)
- PIK3R5 (37)
- LIMK1 (33)
- BRAF (30)
- CD14 (30)
- MAPK1 (29)
- PIK3CD (28)
- HRAS (27)
- PTK2 (26)
- BCAR1 (25)
- PIK3CA (23)
- FGFR2 (22)
- ITGB3 (21)
- IQGAP1 (20)
- PAK1 (20)
- FGF21 (19)
- FN1 (19)
- MAP2K2 (19)
- PDGFRA (17)
- PDGFRB (17)
- CFL1 (16)
- EGF (16)
- ITGAM (16)
- SHC1 (16)
- APC (15)
- MYL7 (15)
- BAIAP2 (13)
- PIKFYVE (12)
- ARAF (11)
- FGFR3 (11)
- PFN1 (11)
- RAF1 (11)
- WASL (11)
- FGF2 (10)
- ACTB (9)
- ACTN1 (9)
- INS (9)
- PIK3R1 (9)
- PXN (9)
- FGFR1 (8)
- ITGA6 (8)
- MAPK3 (8)
- NRAS (8)
- PPP1CA (8)
- F2R (7)
- GSN (7)
- LIMK2 (7)
- NCF1 (7)
- PAK4 (7)
- PDGFB (7)
- PIP4K2A (7)
- ROCK2 (7)
- ACTN2 (6)
- ITGAX (6)
- ITGB1 (6)
- MSN (6)
- PDGFA (6)
- ARPC5 (5)
- FGF13 (5)
- ITGA3 (5)
- PAK2 (5)
- ACTN4 (4)
- CHRM1 (4)
- CRK (4)
- CRKL (4)
- FGF1 (4)
- FGF4 (4)
- FGF7 (4)
- ITGA4 (4)
- ITGB2 (4)
- ITGB4 (4)
- MYH9 (4)
- PPP1CB (4)
- ROCK1 (4)
- VCL (4)
- ACTN3 (3)
- BDKRB2 (3)
- CHRM2 (3)
- EZR (3)
- ITGA2 (3)
- ITGA2B (3)
- ITGAL (3)
- MYL2 (3)
- MYLK3 (3)
- PAK3 (3)
- PAK5 (3)
- PAK6 (3)
- RDX (3)
- SLC9A1 (3)
- WASF1 (3)
- ACTG1 (2)
- APC2 (2)
- ARPC2 (2)
- BDKRB1 (2)
- BRK1 (2)
- CHRM5 (2)
- CSK (2)
- DOCK1 (2)
Reactivities
- Human (1099)
- Mouse (937)
- Rat (896)
- Dog (274)
- Monkey (265)
- Bovine (23)
- Chicken (9)
- Pig (9)
- Rhesus Monkey (7)
- Horse (6)
- Xenopus (6)
- Hamster (4)
- Rabbit (4)
- X. tropicalis (4)
- Bat (3)
- Gorilla (3)
- Cow (2)
- Guinea Pig (2)
- Porcine (2)
- Sheep (2)
- Zebrafish (2)
- All Species (1)
- Avian (1)
- Chimpanzee (1)
- Gibbon (1)
- Orang-Utan (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1250)
- Protein Kinase (551)
- ES Cell Differentiation/IPS (345)
- Transmembrane (303)
- Secreted Protein (174)
- Adult stem cells (134)
- Embryonic stem cells (75)
- Cancer stem cells (59)
- Stem cell relevant signaling - JAK/STAT signaling pathway (59)
- Stem cell - Pluripotency (44)
- GPCR (22)
- Induced pluripotent stem cells (21)
- Phosphatase (16)
- Transcription Factors (6)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Protease (2)