Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
USD 524.00
In Stock
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Rat
Applications
- IHC
Pathways
- Regulation of actin cytoskeleton
Filter by
Category
Target Symbol
- MAP2K1 (173)
- PIK3CG (50)
- PIK3R5 (35)
- EGFR (31)
- MAPK1 (29)
- LIMK1 (27)
- HRAS (26)
- PIK3CD (25)
- BCAR1 (24)
- BRAF (24)
- PIK3CA (21)
- IQGAP1 (20)
- FN1 (17)
- MAP2K2 (17)
- PTK2 (17)
- FGFR2 (16)
- MYL7 (15)
- PDGFRA (15)
- APC (14)
- SHC1 (13)
- BAIAP2 (12)
- PIKFYVE (12)
- ARAF (11)
- ITGB3 (11)
- PFN1 (11)
- FGFR3 (8)
- PAK1 (8)
- ACTN1 (7)
- MAPK3 (7)
- PDGFRB (7)
- FGF2 (6)
- NRAS (6)
- PAK4 (6)
- PIP4K2A (6)
- PPP1CA (6)
- ACTB (5)
- ARPC5 (5)
- FGF13 (5)
- PXN (5)
- RAF1 (5)
- CFL1 (4)
- CHRM1 (4)
- PAK2 (4)
- PIK3R1 (4)
- PPP1CB (4)
- ROCK2 (4)
- BDKRB2 (3)
- INS (3)
- ITGAM (3)
- LIMK2 (3)
- PAK5 (3)
- CHRM2 (2)
- EGF (2)
- EZR (2)
- F2R (2)
- FGF1 (2)
- FGF7 (2)
- FGFR1 (2)
- GSN (2)
- ITGA7 (2)
- ITGAL (2)
- ITGAX (2)
- ITGB1 (2)
- ITGB4 (2)
- MSN (2)
- MYL9 (2)
- PAK3 (2)
- PDGFA (2)
- PDGFB (2)
- PFN4 (2)
- PPP1CC (2)
- RAC1 (2)
- ROCK1 (2)
- SLC9A1 (2)
- TMSB4X (2)
- VCL (2)
- WASF2 (2)
- ACTG1 (1)
- ACTN2 (1)
- ACTN4 (1)
- ARHGEF1 (1)
- ARHGEF6 (1)
- ARHGEF7 (1)
- ARPC1A (1)
- ARPC2 (1)
- CDC42 (1)
- CFL2 (1)
- CHRM3 (1)
- CHRM5 (1)
- CRK (1)
- CRKL (1)
- DOCK1 (1)
- F2 (1)
- FGF16 (1)
- FGF18 (1)
- FGF20 (1)
- FGF22 (1)
- FGF3 (1)
- FGF4 (1)
- GNA13 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (862)
- Protein Kinase (422)
- ES Cell Differentiation/IPS (168)
- Transmembrane (122)
- Secreted Protein (91)
- Adult stem cells (37)
- Cancer stem cells (31)
- Stem cell relevant signaling - JAK/STAT signaling pathway (31)
- Stem cell - Pluripotency (26)
- GPCR (13)
- Phosphatase (13)
- Embryonic stem cells (6)
- Induced pluripotent stem cells (4)
- Transcription Factors (2)
- Protease (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)