DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit anti-Histone H4K20me2 Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4 |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
MonoMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
MonoMethyl-Histone H3-K9 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3 |
TriMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic tri-methylated peptide corresponding to residues surrounding K36 of human histone H3 |
MonoMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
USD 320.00
2 Weeks
Complement C5 (C5) (neoepitope) mouse monoclonal antibody, clone HCC5b.1 (neo), Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Goat, Human, Porcine, Primate |
USD 745.00
5 Days
Complement C4A (C4A) (neoepitope) mouse monoclonal antibody, clone 057-51.5.1.6, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
Symmetric DiMethyl-Histone H3-R2 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R2 of human histone H3 |
MonoMethyl-Histone H3-R17 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic mono-methylated peptide peptide corresponding to residues surrounding Arg17of human histone H3 |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
USD 300.00
In Stock
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
C1QA goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization. |
Rabbit Polyclonal Anti-SNRPD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL |
Complement C3 (C3) goat polyclonal antibody, FITC
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | C3c is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization. |
TriMethyl-Histone H3-K14 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K14 of human histone H3 |
Rabbit Polyclonal Anti-TROVE2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS |
Rabbit Polyclonal Anti-TROVE2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR |
Complement C3 (C3) mouse monoclonal antibody, clone 10-02A, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
CD28 mouse monoclonal antibody, clone CD28.2, Azide Free
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Human, Primate |
Neutrophil Elastase sheep polyclonal antibody, Ion exchange chromatography
| Applications | ELISA, Ie, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Neutrophil elastase (active-site blocked) prepared from human sputum. |
Complement C3 (C3) mouse monoclonal antibody, clone H11, Purified
| Applications | IHC, WB |
| Reactivities | Human |
Histone H3 Rabbit Polyclonal Antibody
| Applications | ChIP, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Histone H3 |
CD28 mouse monoclonal antibody, clone CD28.2, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Human, Primate |
Germany
Japan
United Kingdom
China
