Antibodies

Jump to Filters

Download

1 - 50 of 1412 results

Page 1 of 29

(reset)

CTLA4 Mouse Monoclonal Antibody [Clone ID: UMAB249]

UM800141CF

USD 614.00

In Stock

Carrier-free (BSA/glycerol-free) CTLA4 mouse monoclonal antibody,clone UMAB249

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

CTLA4 (N-term) Rabbit Polyclonal Antibody

AP52146PU-N

USD 450.00

2 Weeks

CTLA4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 50-78 amino acids from the N-terminal region of Human CD152 / CTLA4.

1 / 2

2 / 2

Previous Next

NFKB1 Rabbit Polyclonal Antibody

TA309944

USD 370.00

3 Weeks

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications	Phospho-specific

Interferon gamma (IFNG) Rabbit Polyclonal Antibody

TA349348

USD 380.00

In Stock

Rabbit Polyclonal Anti-IFNG Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human IFNG

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAK2 Rabbit Polyclonal Antibody

TA349426

USD 380.00

In Stock

Rabbit Polyclonal Anti-PAK2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human PAK2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CDK4 Rabbit Polyclonal Antibody

TA326832

USD 275.00

3 Weeks

Rabbit anti-CDK4 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Center-peptide of human CDK4

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAK2 Rabbit Polyclonal Antibody

TA306346

USD 430.00

In Stock

Rabbit Polyclonal PAK2 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GRB2 Rabbit Polyclonal Antibody

TA349332

USD 380.00

In Stock

Rabbit Polyclonal Anti-GRB2 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NFAT4 (NFATC3) Rabbit Polyclonal Antibody

TA349413

USD 380.00

In Stock

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human NFATC3

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PAK6 Rabbit Polyclonal Antibody

TA349427

USD 380.00

In Stock

Rabbit Polyclonal Anti-PAK6 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human PAK6

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NF-kB p65 (RELA) Mouse Monoclonal Antibody [Clone ID: 27F9.G4]

TA319553

USD 530.00

2 Weeks

Mouse monoclonal NF-kB p65 antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IKB beta (NFKBIB) Rabbit Polyclonal Antibody

TA332909

USD 275.00

3 Weeks

Rabbit anti-NFKBIB Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human NFKBIB

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NF-kB p65 (RELA) Mouse Monoclonal Antibody [Clone ID: 112A1021]

TA336457

USD 479.00

In Stock

Mouse Monoclonal RelA/NFkB p65 Antibody (112A1021)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CD4 Mouse Monoclonal Antibody [Clone ID: B-A1]

AM31216AF-N

USD 270.00

2 Weeks

CD4 mouse monoclonal antibody, clone B-A1, Azide Free

Applications	FC, FN, IHC
Reactivities	Human

c Fos (FOS) Rabbit Polyclonal Antibody

TA349276

USD 380.00

In Stock

Rabbit Polyclonal Anti-FOS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human FOS

1 / 3

2 / 3

3 / 3

Previous Next

RAF1 Rabbit Polyclonal Antibody

TA349287

USD 380.00

In Stock

Rabbit Polyclonal Anti-RAF1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human RAF1

1 / 3

2 / 3

3 / 3

Previous Next

IKK gamma (IKBKG) Rabbit Polyclonal Antibody

TA326862

USD 275.00

3 Weeks

Rabbit anti-IKBKG Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human IKBKG

1 / 3

2 / 3

3 / 3

Previous Next

IKB alpha (NFKBIA) Rabbit Polyclonal Antibody

TA326981

USD 275.00

3 Weeks

NFKBIA Rabbit Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human NFKBIA

1 / 3

2 / 3

3 / 3

Previous Next

CD4 Rabbit Polyclonal Antibody

TA336736

USD 479.00

2 Weeks

Rabbit Polyclonal CD4 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Rabbit
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730]

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

PI 3 Kinase p85 alpha (PIK3R1) Rabbit Polyclonal Antibody

AP20772PU-N

USD 370.00

2 Weeks

PI 3 Kinase p85 alpha (PIK3R1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide, corresponding to amino acids 470-510 of Human PI3K p85α.

1 / 2

2 / 2

Previous Next

AKT1 Rabbit Polyclonal Antibody

TA313266

USD 345.00

4 Weeks

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications	Phospho-specific

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CD45 (PTPRC) (CD45RC) Mouse Monoclonal Antibody [Clone ID: MT2]

AM39022PU-N

USD 280.00

2 Weeks

CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified

Applications	FC, IF, IHC
Reactivities	Human

IL10 (Center) Rabbit Polyclonal Antibody

AP52181PU-N

USD 450.00

2 Weeks

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

1 / 3

2 / 3

3 / 3

Previous Next

Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody

TA308146

USD 415.00

In Stock

Rabbit Polyclonal antibody to Calcium binding protein P22

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 47 and 141 of Calcium binding protein P22 (Uniprot ID#Q99653)

1 / 3

2 / 3

3 / 3

Previous Next

AKT1 Mouse Monoclonal Antibody [Clone ID: 17F6.B11]

TA319562

USD 530.00

2 Weeks

Mouse monoclonal Akt phospho S473 antibody

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

CD247 Rabbit Polyclonal Antibody

TA327247

USD 275.00

3 Weeks

CD247 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human CD247

1 / 2

2 / 2

Previous Next

IKK alpha (CHUK) Rabbit Polyclonal Antibody

TA327250

USD 275.00

3 Weeks

Rabbit anti-CHUK Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human CHUK

1 / 2

2 / 2

Previous Next

PI 3 Kinase catalytic subunit alpha (PIK3CA) Rabbit Polyclonal Antibody

TA302178

USD 450.00

2 Weeks

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.

1 / 3

2 / 3

3 / 3

Previous Next

MEK7 (MAP2K7) Rabbit Polyclonal Antibody

TA312581

USD 345.00

In Stock

Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

NFAT2 (NFATC1) Rabbit Polyclonal Antibody

TA327069

USD 275.00

3 Weeks

NFATC1 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human NFATC1

1 / 2

2 / 2

Previous Next

ZAP70 Rabbit Polyclonal Antibody

TA333306

USD 352.00

3 Weeks

Phospho-ZAP70-Y493 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding Y493 of human ZAP70
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

c-Jun (JUN) Rabbit Polyclonal Antibody

TA349218

USD 380.00

In Stock

Rabbit Polyclonal Anti-JUN Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human JUN

1 / 2

2 / 2

Previous Next

MEK1 (MAP2K1) Rabbit Polyclonal Antibody

TA349388

USD 380.00

In Stock

Rabbit Polyclonal Anti-MAP2K1 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human MAP2K1

1 / 2

2 / 2

Previous Next

IL5 Rabbit Polyclonal Antibody

AP20595PU-N

USD 370.00

2 Weeks

IL5 rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5

1 / 2

2 / 2

Previous Next

CD8A Rabbit Monoclonal Antibody [Clone ID: EP1150Y]

TA300779

USD 527.00

In Stock

Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

CD8A Rabbit Polyclonal Antibody

TA302180

USD 450.00

5 Days

Rabbit Polyclonal Antibody against CD8A (N-term)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TNFA.

1 / 2

2 / 2

Previous Next

NFKB1 Rabbit Polyclonal Antibody

TA336824

USD 424.00

5 Days

Rabbit Polyclonal NFkB1/NFkB p105 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NFAT1 (NFATC2) Rabbit Polyclonal Antibody

TA343699

USD 475.00

5 Days

Rabbit Polyclonal Anti-NFATC2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE

1 / 2

2 / 2

Previous Next

MALT1 Rabbit Polyclonal Antibody

TA349149

USD 484.00

5 Days

Rabbit Polyclonal Anti-ADRM1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	ADRM1 antibody was raised against a 19 amino acid peptide near the center of human ADRM1.

1 / 2

2 / 2

Previous Next

c-Jun (JUN) Rabbit Polyclonal Antibody

TA590119

USD 409.00

In Stock

Rabbit Polyclonal c-jun Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

c Fos (FOS) (4-17) Rabbit Polyclonal Antibody

26209

USD 540.00

3 Days

c Fos (FOS) (4-17) rabbit polyclonal antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

CD28 Mouse Monoclonal Antibody [Clone ID: CD28.2]

AM12006AF-N

USD 220.00

2 Weeks

CD28 mouse monoclonal antibody, clone CD28.2, Azide Free

Applications	FC, FN, IF, IHC, IP, WB
Reactivities	Human, Primate

CD4 Mouse Monoclonal Antibody [Clone ID: EDU-2]

AM26053PU-N

USD 435.00

2 Weeks

CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified

Applications	FC, IHC
Reactivities	Human

GM CSF (CSF2) (Center) Rabbit Polyclonal Antibody

AP51097PU-N

USD 450.00

2 Weeks

GM CSF (CSF2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 59-85 amino acids from the Central region of Human CSF2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL10 Rabbit Polyclonal Antibody

PP1032P1

USD 260.00

2 Weeks

IL10 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

1 / 3

2 / 3

3 / 3

Previous Next

CARD11 Rabbit Polyclonal Antibody

TA306139

USD 430.00

In Stock

Rabbit Polyclonal CARMA1 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	CARMA1 antibody was raised against a synthetic peptide corresponding to amino acids at the C-terminus of human CARMA1.

1 / 3

2 / 3

3 / 3

Previous Next

AKT1 Rabbit Polyclonal Antibody

TA313265

USD 345.00

4 Weeks

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

p38 (MAPK14) Rabbit Polyclonal Antibody

TA326205

USD 345.00

In Stock

Rabbit polyclonal p38 MAPK (Ab-322) antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q).

1 / 3

2 / 3

3 / 3

Previous Next

1 - 50 of 1412 results

Page 1 of 29