Germany
Japan
United Kingdom
China
Antibodies
View as table Download
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010) |
MCM3 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM3 |
KPNA2 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KPNA2 |
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
Rabbit anti-LSM4 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LSM4 |
Rabbit anti-SMARCC1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SMARCC1 |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Mouse Monoclonal RPA70 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal KAP1 / TIF1 beta Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone 916
| Applications | ELISA, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Mouse Monoclonal Hsp60 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal RPA32/RPA2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Ku80 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Mouse monoclonal Hsp90 complex Antibody
| Applications | IP |
| Reactivities | Human, Mouse, Rat, Rabbit. Not tested on other species |
| Conjugation | Unconjugated |
Mouse Monoclonal FEN-1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal RAD9A Antibody
| Applications | IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal SIRT1 Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal anti-HSP90AB1 Antibody
| Applications | IP |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Ku80/XRCC5 Antibody
| Applications | IP |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to residues 323-338 [FSKVDEEQMKYKSEGK] of the 80 kDa Ku80 protein. |
Carrier-free (BSA/glycerol-free) SSB mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Human
Applications
- IP
Families
- Stem cell - Pluripotency
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- DNA replication (43)
- Nucleotide excision repair (40)
- Mismatch repair (39)
- Homologous recombination (38)
- Cell cycle (32)
- Systemic lupus erythematosus (30)
- p53 signaling pathway (27)
- Non-homologous end-joining (6)
- Pathways in cancer (5)
- Progesterone-mediated oocyte maturation (4)
- Prostate cancer (3)
- RNA degradation (3)
- Antigen processing and presentation (2)
- Chronic myeloid leukemia (2)
- Gap junction (2)
- Huntington's disease (2)
- NOD-like receptor signaling pathway (2)
- Notch signaling pathway (2)
- Oocyte meiosis (2)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Base excision repair (1)
- Cardiac muscle contraction (1)
- Colorectal cancer (1)
- Dilated cardiomyopathy (1)
- Focal adhesion (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Neurotrophin signaling pathway (1)
- Proteasome (1)
- Small cell lung cancer (1)
- Spliceosome (1)
- Type I diabetes mellitus (1)