Germany
Japan
United Kingdom
China
Antibodies
Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Active filters
Applications
- WB
Clonalities
- Polyclonal
Families
- Transmembrane
Filter by
Target Symbol
- EGFR (55)
- ERBB2 (26)
- KDR (26)
- CSF1R (20)
- MET (20)
- APP (18)
- FGFR1 (18)
- BCL2 (17)
- CANX (16)
- PDGFRB (16)
- BAX (15)
- GJA1 (15)
- IGF1R (15)
- BCL2L1 (14)
- KIT (14)
- SYT1 (14)
- AIFM1 (13)
- CXCR4 (13)
- EGF (13)
- ICAM1 (13)
- NGFR (13)
- CLDN7 (12)
- EPOR (12)
- GRIA1 (12)
- GRIN2B (12)
- KITLG (12)
- CAV1 (11)
- CDH1 (11)
- EFNB2 (11)
- FGF4 (11)
- HTR3A (11)
- P2RX2 (11)
- PECAM1 (11)
- PTGS1 (11)
- TNFSF11 (11)
- CD19 (10)
- COX4I1 (10)
- CRHR2 (10)
- DLL4 (10)
- EPHA2 (10)
- F2R (10)
- GRIN1 (10)
- ITGB3 (10)
- NTRK2 (10)
- ORAI1 (10)
- SCARB2 (10)
- TLR3 (10)
- VCAM1 (10)
- ACPP (9)
- ACVR1 (9)
- ADRA1B (9)
- ADRB2 (9)
- CLDN1 (9)
- CYP1A1 (9)
- CYP2D6 (9)
- HMOX1 (9)
- LYVE1 (9)
- MCL1 (9)
- MIA2 (9)
- MUC1 (9)
- NRG1 (9)
- SOX1 (9)
- TLR4 (9)
- TNFSF13 (9)
- TRPM8 (9)
- ACE2 (8)
- AGER (8)
- BAK1 (8)
- BDNF (8)
- CASR (8)
- CCR7 (8)
- CD247 (8)
- CX3CR1 (8)
- DIABLO (8)
- F10 (8)
- FLT3 (8)
- GRIA2 (8)
- HRK (8)
- IFNB1 (8)
- IL2RB (8)
- ITGA4 (8)
- MFN2 (8)
- NOTCH2 (8)
- P2RY2 (8)
- PDGFRA (8)
- SCARB1 (8)
- TGFBR2 (8)
- TNFRSF10B (8)
- TNFRSF1A (8)
- ABCD4 (7)
- ADAM17 (7)
- ANTXR1 (7)
- ASPH (7)
- BCAP31 (7)
- CADM4 (7)
- CAV2 (7)
- CCR2 (7)
- CD40 (7)
- CD44 (7)
- CERS5 (7)
Reactivities
- Human (7459)
- Mouse (3047)
- Rat (2380)
- Dog (203)
- Cow (129)
- Bovine (115)
- Pig (102)
- Monkey (57)
- Canine (45)
- Chicken (35)
- Primate (35)
- Rabbit (32)
- Rhesus Monkey (28)
- Hamster (21)
- Xenopus (18)
- Sheep (16)
- Chimpanzee (15)
- Zebrafish (15)
- Porcine (14)
- Guinea Pig (11)
- X. tropicalis (9)
- Macaque (7)
- Drosophila (5)
- Feline (5)
- Equine (4)
- Quail (3)
- Avian (2)
- Fish (2)
- Canis (1)
- Eukaryote (1)
- Goat (1)
- Mink (1)
- Murine (1)
- Mustelid (1)
- Opossum (1)
Antibody Hosts
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (834)
- Cytokine-cytokine receptor interaction (761)
- Metabolic pathways (613)
- Pathways in cancer (485)
- Calcium signaling pathway (426)
- Olfactory transduction (416)
- Cell adhesion molecules (CAMs) (390)
- Endocytosis (306)
- Focal adhesion (290)
- Hematopoietic cell lineage (289)
- Regulation of actin cytoskeleton (254)
- MAPK signaling pathway (245)
- Colorectal cancer (208)
- Adherens junction (187)
- Leukocyte transendothelial migration (184)
- Prostate cancer (179)
- Alzheimer's disease (176)
- Melanoma (176)
- Jak-STAT signaling pathway (171)
- Gap junction (161)
- Axon guidance (153)
- Natural killer cell mediated cytotoxicity (153)
- Pancreatic cancer (138)
- Dilated cardiomyopathy (137)
- Melanogenesis (134)
- Epithelial cell signaling in Helicobacter pylori infection (130)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (126)
- ErbB signaling pathway (126)
- Chemokine signaling pathway (125)
- Amyotrophic lateral sclerosis (ALS) (121)
- Apoptosis (119)
- Hypertrophic cardiomyopathy (HCM) (119)
- Bladder cancer (112)
- Glioma (110)
- Antigen processing and presentation (106)
- ECM-receptor interaction (106)
- Endometrial cancer (105)
- Toll-like receptor signaling pathway (104)
- ABC transporters (101)
- Huntington's disease (101)
- Vascular smooth muscle contraction (98)
- Viral myocarditis (98)
- Non-small cell lung cancer (97)
- Tight junction (93)
- Lysosome (89)
- Neurotrophin signaling pathway (89)
- Drug metabolism - cytochrome P450 (88)
- Retinol metabolism (88)
- GnRH signaling pathway (87)
- Wnt signaling pathway (84)
- Basal cell carcinoma (82)
- Systemic lupus erythematosus (80)
- Parkinson's disease (77)
- Adipocytokine signaling pathway (72)
- Graft-versus-host disease (72)
- Oxidative phosphorylation (72)
- Cardiac muscle contraction (68)
- Autoimmune thyroid disease (67)
- Allograft rejection (66)
- Metabolism of xenobiotics by cytochrome P450 (66)
- TGF-beta signaling pathway (66)
- Long-term potentiation (64)
- Primary immunodeficiency (64)
- Dorso-ventral axis formation (63)
- Notch signaling pathway (61)
- SNARE interactions in vesicular transport (61)
- PPAR signaling pathway (60)
- Drug metabolism - other enzymes (59)
- N-Glycan biosynthesis (58)
- Small cell lung cancer (57)
- Sphingolipid metabolism (57)
- Type I diabetes mellitus (57)
- Long-term depression (56)
- T cell receptor signaling pathway (53)
- Glycerophospholipid metabolism (52)
- Arachidonic acid metabolism (51)
- Asthma (51)
- Hedgehog signaling pathway (51)
- Vibrio cholerae infection (49)
- Complement and coagulation cascades (48)
- Purine metabolism (47)
- p53 signaling pathway (46)
- Androgen and estrogen metabolism (45)
- Pathogenic Escherichia coli infection (43)
- Renin-angiotensin system (43)
- Renal cell carcinoma (42)
- Taste transduction (42)
- Chronic myeloid leukemia (41)
- Glycerolipid metabolism (41)
- Porphyrin and chlorophyll metabolism (41)
- O-Glycan biosynthesis (37)
- Tyrosine metabolism (37)
- Fatty acid metabolism (36)
- B cell receptor signaling pathway (35)
- Progesterone-mediated oocyte maturation (35)
- Linoleic acid metabolism (34)
- Prion diseases (34)
- Starch and sucrose metabolism (33)
- Ether lipid metabolism (31)
- Fc gamma R-mediated phagocytosis (31)
- Oocyte meiosis (31)
- Biosynthesis of unsaturated fatty acids (30)
- Heparan sulfate biosynthesis (30)
- VEGF signaling pathway (30)
- Pyrimidine metabolism (29)
- RIG-I-like receptor signaling pathway (29)
- Chondroitin sulfate biosynthesis (28)
- Glycosphingolipid biosynthesis - lacto and neolacto series (28)
- Acute myeloid leukemia (27)
- Keratan sulfate biosynthesis (26)
- Ascorbate and aldarate metabolism (25)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (25)
- Cytosolic DNA-sensing pathway (24)
- Pentose and glucuronate interconversions (24)
- Type II diabetes mellitus (24)
- Glutathione metabolism (23)
- Riboflavin metabolism (23)
- Tryptophan metabolism (23)
- Fc epsilon RI signaling pathway (22)
- Caffeine metabolism (21)
- Thyroid cancer (21)
- Insulin signaling pathway (20)
- Glycosphingolipid biosynthesis - ganglio series (18)
- Primary bile acid biosynthesis (17)
- Glycosphingolipid biosynthesis - globo series (15)
- Glycosaminoglycan degradation (13)
- NOD-like receptor signaling pathway (13)
- Nicotinate and nicotinamide metabolism (13)
- Steroid biosynthesis (13)
- Glycine (11)
- Propanoate metabolism (11)
- Valine (11)
- leucine and isoleucine degradation (11)
- serine and threonine metabolism (11)
- C21-Steroid hormone metabolism (10)
- Cell cycle (10)
- Nitrogen metabolism (10)
- Phenylalanine metabolism (10)
- Ubiquitin mediated proteolysis (10)
- beta-Alanine metabolism (10)
- Arginine and proline metabolism (9)
- Galactose metabolism (9)
- Histidine metabolism (9)
- Amino sugar and nucleotide sugar metabolism (7)
- Cyanoamino acid metabolism (7)
- Glycolysis / Gluconeogenesis (7)
- Lysine degradation (7)
- Phosphatidylinositol signaling system (7)
- Selenoamino acid metabolism (7)
- Taurine and hypotaurine metabolism (7)
- Inositol phosphate metabolism (6)
- Limonene and pinene degradation (6)
- alpha-Linolenic acid metabolism (6)
- Base excision repair (5)
- Butanoate metabolism (5)
- O-Mannosyl glycan biosynthesis (5)
- Pyruvate metabolism (5)
- Sulfur metabolism (5)
- Maturity onset diabetes of the young (2)
- Other glycan degradation (2)
- Terpenoid backbone biosynthesis (2)
- Citrate cycle (TCA cycle) (1)
- Pantothenate and CoA biosynthesis (1)
- Protein export (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)