Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Conjugates
- Unconjugated
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (134)
- JUN (116)
- ERBB2 (100)
- EGFR (94)
- CTNNB1 (93)
- AKT1 (88)
- BRAF (61)
- BCL2 (57)
- VWF (55)
- MAPK1 (43)
- MET (40)
- PIK3CG (39)
- PARVA (36)
- PDGFRA (34)
- VEGFA (31)
- PXN (30)
- ACTB (28)
- KDR (28)
- MAPK8 (28)
- VASP (28)
- HRAS (27)
- PIK3R5 (27)
- AKT2 (26)
- BIRC3 (26)
- PDGFRB (26)
- CCND2 (25)
- SPP1 (25)
- RAPGEF1 (22)
- SHC1 (22)
- PTK2 (21)
- BCAR1 (20)
- CCND1 (20)
- LAMB3 (20)
- PARVB (20)
- IGF1R (19)
- MAPK9 (19)
- PIK3CD (19)
- RAF1 (18)
- PRKCA (17)
- CAV1 (16)
- HGF (16)
- MYL7 (16)
- VEGFB (16)
- GSK3B (15)
- IGF1 (15)
- PTEN (15)
- SRC (15)
- BAD (14)
- FN1 (14)
- MAPK3 (14)
- PAK4 (14)
- VEGFD (14)
- FLT4 (13)
- MAPK10 (13)
- EGF (12)
- FLT1 (12)
- ITGB1 (12)
- PAK1 (12)
- ROCK2 (12)
- AKT3 (11)
- PRKCB (11)
- VCL (11)
- FYN (10)
- ITGB3 (10)
- ACTN1 (9)
- ELK1 (9)
- LAMA4 (9)
- PPP1CA (9)
- CAPN2 (8)
- PIK3R1 (8)
- CAV2 (7)
- FLNA (7)
- ILK (7)
- PDGFB (7)
- RHOA (7)
- VAV1 (7)
- CCND3 (6)
- COL3A1 (6)
- GRB2 (6)
- ITGAV (6)
- MYL9 (6)
- PAK2 (6)
- PDPK1 (6)
- PGF (6)
- PPP1CB (6)
- VEGFC (6)
- XIAP (6)
- ZYX (6)
- ACTG1 (5)
- ACTN2 (5)
- ACTN4 (5)
- BIRC2 (5)
- CDC42 (5)
- ITGA4 (5)
- ITGB4 (5)
- PAK5 (5)
- PRKCG (5)
- RAC1 (5)
- COL1A1 (4)
- COL1A2 (4)
Reactivities
- Human (2306)
- Mouse (1931)
- Rat (1826)
- Dog (340)
- Monkey (325)
- Bovine (36)
- Chicken (34)
- Pig (19)
- Rabbit (18)
- Cow (13)
- Xenopus (12)
- Canine (11)
- Canis (8)
- Drosophila (8)
- Hamster (8)
- Rhesus Monkey (8)
- Primate (5)
- Sheep (5)
- X. tropicalis (5)
- Zebrafish (4)
- Guinea Pig (3)
- Porcine (3)
- C. elegans (2)
- Chimpanzee (2)
- All Species (1)
- Avian (1)
- Broad (1)
- Feline (1)
- Goat (1)
- Horse (1)
- Tobacco hornworm (1)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (2174)
- Protein Kinase (992)
- ES Cell Differentiation/IPS (849)
- Transmembrane (526)
- Secreted Protein (345)
- Transcription Factors (229)
- Stem cell - Pluripotency (155)
- Stem cell relevant signaling - JAK/STAT signaling pathway (129)
- Adult stem cells (126)
- Cancer stem cells (94)
- Phosphatase (34)
- Protease (24)
- Stem cell relevant signaling - DSL/Notch pathway (20)
- Stem cell relevant signaling - Wnt Signaling pathway (20)
- Embryonic stem cells (16)
- Induced pluripotent stem cells (16)