Antibodies

View as table Download

Rabbit anti-DLD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DLD

Rabbit Polyclonal Anti-DLD Antibody - middle region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-ACAT1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACAT1

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Rabbit anti-HSD17B10 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSD17B10

Mouse monoclonal ALDH2 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-HADHA Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HADHA

Rabbit anti-ABAT Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABAT

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1.

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit anti-ACADM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACADM

Rabbit anti-PCCB Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PCCB

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the C terminal of human HMGCS2. Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.

Rabbit polyclonal ERAB antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERAB.

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Rabbit Polyclonal Anti-IVD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the N terminal of human HMGCS2. Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE

Rabbit Polyclonal Anti-HMGCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the N terminal of human HMGCL. Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA

Rabbit Polyclonal Anti-HMGCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the C terminal of human HMGCL. Synthetic peptide located within the following region: LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL

Rabbit Polyclonal Anti-ERAB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ERAB Antibody: Peptide sequence around aa.253~257(L-D-G-A-I)derived from Human ERAB.

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT1

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

Rabbit Polyclonal antibody to BCAT2 (branched chain aminotransferase 2, mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of BCAT2 (Uniprot ID#O15382)

Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440)

Rabbit Polyclonal antibody to HMGCL (3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 325 of HMGCL (Uniprot ID#P35914)

Rabbit polyclonal anti-ALDH1B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1.

Rabbit polyclonal anti-IL4I1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1.

Rabbit polyclonal HADHA Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA.

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

Rabbit Polyclonal Anti-PCCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Rabbit polyclonal Anti-BCKDHA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCKDHA antibody: synthetic peptide directed towards the N terminal of human BCKDHA. Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY

Rabbit Polyclonal Anti-ALDH1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALDH1B1

Goat Polyclonal Antibody against ACADM

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RLIVAREHIDKYKN, from the C Terminus of the protein sequence according to NP_000007.1.

Rabbit Polyclonal Aldh3A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2.

Rabbit anti-ACAT2 polyclonal antibody

Applications WB
Reactivities Human, Murine, Rat, Porcine, Ovine
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ACAT 2

Goat Anti-ALDH2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DETQFKKILGYIN, from the internal region of the protein sequence according to NP_000681.2.

Goat Anti-ALDH9A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKEILDKFTEEVVKQ, from the internal region of the protein sequence according to NP_000687.3.

Goat Anti-ALDH6A1 (aa487-496) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1.

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

Rabbit Polyclonal Anti-DBT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DBT antibody is: synthetic peptide directed towards the N-terminal region of Human DBT. Synthetic peptide located within the following region: EWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVG

Goat Polyclonal Antibody against HADH2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CIRLDGAIRMQP, from the C Terminus of the protein sequence according to NP_004484.