Antibodies

View as table Download

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C

Rabbit Polyclonal Anti-DUSP10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP10

USD 300.00

In Stock

Goat Polyclonal Anti-CD45 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli.

Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Polyclonal Anti-DUSP19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP19

Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318
Modifications Phospho-specific

Rabbit anti-PPP1CB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CB

Rabbit Polyclonal Anti-RSPO3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RSPO3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human RSPO3.

PTPN2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTPN2

Rabbit anti-PPP2R2A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R2A

CDKN3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CDKN3

Rabbit Polyclonal Anti-NDST2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NDST2 antibody was raised against a 16 amino acid peptide near the amino terminus of human NDST2

Mouse anti pTEN Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP3CA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP3CA

Rabbit anti-PTPN6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTPN6

Rabbit Polyclonal antibody to DUSP26 (dual specificity phosphatase 26 (putative))

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 117 of DUSP26 (Uniprot ID#Q9BV47)

Goat Polyclonal Anti-DUSP6 / MKP3 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-DUSP6 / MKP3 Antibody: Peptide with sequence C-PSNQNVYQVDSLQST, from the C Terminus of the protein sequence according to NP_001937.2; NP_073143.2.

Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873)

Rabbit Polyclonal antibody to SET (SET nuclear oncogene)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of SET

Rabbit polyclonal MKP1 (Ab-359) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MKP1 around the phosphorylation site of serine 359 (L-Q-SP-P-I).

Anti-PTPRK Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

CDC25A Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC25A

Rabbit anti-PPP1CA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CA

Rabbit Polyclonal Anti-PPP2R2C Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp2r2c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY

Rabbit Polyclonal antibody to DUSP6 (dual specificity phosphatase 6)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 82 and 370 of DUSP6 (Uniprot ID#Q16828)

CDC25C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC25C

Rabbit anti-PPP2R1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A

Rabbit anti-PPM1D Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPM1D

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp2r5e antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

Rabbit Monoclonal Antibody against PTPN11 (Clone Y477)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against B56 beta isoform

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRLTPQVAASGGQS, from the C Terminus of the protein sequence according to NP_006235.1.

Rabbit Polyclonal SIRP alpha Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIRP alpha antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human SIRP alpha 1? The sequences of the immunogenic peptide differ from those of mouse, rat and bovine by one amino acid.

Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330)

Rabbit Polyclonal antibody to CTDSP2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 26 and 271 of CTDSP2 (Uniprot ID#O14595)

Rabbit Polyclonal antibody to DUSP8 (dual specificity phosphatase 8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of DUSP8 (Uniprot ID#Q13202)

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.

Rabbit polyclonal anti-PTPRZ1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human PTPRZ1.

Rabbit polyclonal anti-PTPN22 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PTPN22.

Rabbit polyclonal anti-SSH3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SSH3.

Rabbit polyclonal anti-ILKAP antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ILKAP.

Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN.
Modifications Phospho-specific

Rabbit polyclonal PTP4A2 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PTP4A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-59 amino acids from the Central region of human PTP4A2.

Rabbit polyclonal CTDSP1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CTDSP1.

Rabbit polyclonal DUSP16 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DUSP16.

Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536
Modifications Phospho-specific

Rabbit Polyclonal PTP1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTP1B

Rabbit polyclonal Anti-SET Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI