Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit Polyclonal TLR5 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit Polyclonal Antibody against TIP47
| Applications | WB |
| Reactivities | Human, Primate, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the C-terminus (within residues 350-435) of the human TIP47 protein. [Swiss-Prot# O60664] |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal LRRK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region, within residues 2507–2527 of the human LRRK2 protein, conjugated to KLH. [Swiss-Prot# Q5S007] |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Murine, Rat, Porcine, Ovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
Mouse Monoclonal SIAH1/2 Antibody (8G7H12)
| Applications | WB |
| Reactivities | Human, Rat, Drosophila, Porcine, Zebrafish, Mouse |
| Conjugation | Unconjugated |
HSP70-1A (HSPA1A) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Monkey, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 559 of human Hsp70 |
Mouse Anti-Synaptobrevin (VAMP) Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Syntaxin Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Mouse Monoclonal anti-PDIA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Dog, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142] |
Mouse Monoclonal SF3B4 Antibody (3A1)
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Mouse Monoclonal anti-TIMP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Chicken, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FLI1 Antibody
| Applications | WB |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Kv1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family. |
Germany
Japan
United Kingdom
China
