Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
USD 379.00
In Stock
USD 379.00
In Stock
Goat Anti-IDS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-NOS2A polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human NOS2A. |
Rabbit polyclonal FASN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
Rabbit Polyclonal Anti-GPT Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit Polyclonal Anti-NME7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NME7 |
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Goat Polyclonal Antibody against TUSC3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit polyclonal iNOS (Ab-151) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human iNOS around the phosphorylation site of tyrosine 151 (Q-Y-YP-G-S). |
Rabbit Polyclonal Anti-POLR1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD |
Rabbit Polyclonal Anti-NFKB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NFKB1 |
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BACE1 |
Rabbit Polyclonal Anti-AGPAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AGPAT6 |
Rabbit Polyclonal Anti-ALAS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ALAS2 |
Rabbit Polyclonal Antibody against PTGDS
| Applications | WB |
| Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
Goat Polyclonal Antibody against OGT
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YEHPKDLKLSDGR, from the internal region of the protein sequence according to NP_858058.1; NP_858059.1. |
Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062) |
Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985) |
USD 415.00
In Stock
Germany
Japan
United Kingdom
China
