Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Rabbit polyclonal antibody to CACNA1B (calcium channel, voltage-dependent, N type, alpha 1B subunit)
Applications | IF, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2013 and 2209 of CACNA1B (Uniprot ID#Q00975) |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Mouse Monoclonal ABCG2/CD338 Antibody (3G8)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
Modifications | Phospho-specific |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Primate |
Rabbit polyclonal SLC11A2 Antibody (Center)
Applications | IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Rabbit Polyclonal Anti-Amyloid Oligomers (A11) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Eukaryotes |
Conjugation | Unconjugated |
Immunogen | Synthetic molecular mimic of soluble oligomers. |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
CTLA4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 50-78 amino acids from the N-terminal region of Human CD152 / CTLA4. |
Rabbit Polyclonal Nephrin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
LRRC32 rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 234~260 amino acids from the Center region of Human GARP. |
Rabbit Polyclonal RHBDD2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit Polyclonal STIM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRNA4 |
Rabbit anti-LAMP1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LAMP1 |
Rabbit Polyclonal Anti-HO-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit Polyclonal Vanilloid R1/TRPV1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the rat TRPV1 protein (between residues 1-50) [UniProt O35433] |
Mouse Monoclonal LAMP-2/CD107b Antibody (H4B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse (Negative), Rat (Negative) |
Conjugation | Unconjugated |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
Applications | FC |
Reactivities | Feline, Human, Rabbit |
Conjugation | PE |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
Applications | FC, FN, IHC, IP, WB |
Reactivities | Human |
Rabbit Monoclonal antibody against CD317 / BST2
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ELOVL5 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL5. |
Rabbit polyclonal HLA-G Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
Applications | FC, IHC |
Reactivities | Human |
Rabbit Polyclonal IFN-beta Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |