Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 428.00
In Stock
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-HSBP1 antibody for SISCAPA, clone OTIR5C4
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-IASPP antibody for SISCAPA, clone OTIR1G11
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-FOXO1 antibody for SISCAPA, clone OTIR3H6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Goat Polyclonal Antibody against XBP1 / TREB5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NHSWEDTFANELFPQ, from the internal region of the protein sequence according to NP_001073007.1. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Active filters
Category
- Antibodies
Reactivities
- Rat
Conjugates
- Unconjugated
Families
- Transcription Factors
Filter by
Target Symbol
- JUN (116)
- CTNNB1 (96)
- MAP2K3 (95)
- GLI1 (90)
- NKX2-1 (54)
- STAT5A (47)
- SQSTM1 (45)
- CNOT4 (41)
- FOS (41)
- CBX8 (40)
- SNAI2 (40)
- STAT4 (40)
- NR3C1 (39)
- ERG (38)
- MEF2C (38)
- PSMC3 (37)
- FOXO1 (36)
- RB1 (36)
- MCM2 (35)
- SMAD1 (35)
- TLE1 (35)
- ESR1 (34)
- NAB1 (33)
- ZEB1 (33)
- HDAC4 (32)
- PRRX1 (32)
- NEUROG1 (31)
- PPP5C (31)
- TCF12 (31)
- CDX2 (30)
- CLOCK (30)
- FOSB (30)
- HDAC9 (30)
- NR2E3 (30)
- PARN (30)
- SIRT5 (30)
- GATA3 (29)
- HES1 (29)
- HSF2 (29)
- NR2C2 (29)
- RARA (29)
- SKIL (29)
- STAT1 (29)
- HDAC1 (28)
- LHX1 (28)
- LHX2 (28)
- NR2C1 (28)
- TAL1 (28)
- TET3 (28)
- ELK3 (27)
- FOXO4 (27)
- FOXP3 (27)
- ID3 (27)
- NAB2 (27)
- RFXANK (27)
- MYC (26)
- TSC22D1 (26)
- AR (25)
- BTG2 (25)
- NR4A3 (25)
- SOX17 (25)
- BCL6 (24)
- ELF3 (24)
- HOXC10 (24)
- KLF2 (24)
- SATB1 (24)
- TCEANC2 (24)
- THRA (24)
- UBP1 (24)
- HDAC8 (23)
- HNF4A (23)
- PDX1 (23)
- PPARA (23)
- PPP1R8 (23)
- ATF1 (22)
- BHLHE40 (22)
- MYCN (22)
- POU4F3 (22)
- RELA (22)
- SMAD2 (22)
- ARNT (21)
- TGIF1 (21)
- ESRRG (20)
- NONO (20)
- ATF2 (19)
- CALR (19)
- CREB1 (19)
- ESRRB (19)
- GAS7 (19)
- HIPK1 (19)
- NR5A1 (19)
- POGK (19)
- POLR2H (19)
- RORB (19)
- STAT3 (19)
- TP53 (19)
- TP73 (19)
- GATAD1 (18)
- HHEX (18)
- HOXC4 (18)
Applications
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (959)
- MAPK signaling pathway (561)
- Wnt signaling pathway (393)
- Toll-like receptor signaling pathway (372)
- Colorectal cancer (366)
- Prostate cancer (325)
- Chronic myeloid leukemia (312)
- Cell cycle (306)
- T cell receptor signaling pathway (266)
- Neurotrophin signaling pathway (252)
- TGF-beta signaling pathway (252)
- B cell receptor signaling pathway (250)
- ErbB signaling pathway (233)
- Acute myeloid leukemia (231)
- GnRH signaling pathway (231)
- Pancreatic cancer (231)
- Focal adhesion (230)
- Basal cell carcinoma (213)
- Jak-STAT signaling pathway (209)
- Adherens junction (195)
- Renal cell carcinoma (195)
- Huntington's disease (186)
- Epithelial cell signaling in Helicobacter pylori infection (176)
- Endometrial cancer (174)
- Small cell lung cancer (171)
- Thyroid cancer (163)
- Chemokine signaling pathway (156)
- Adipocytokine signaling pathway (141)
- Melanogenesis (133)
- Maturity onset diabetes of the young (132)
- Amyotrophic lateral sclerosis (ALS) (130)
- Tight junction (122)
- Leukocyte transendothelial migration (110)
- Fc epsilon RI signaling pathway (106)
- Apoptosis (104)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (103)
- Pathogenic Escherichia coli infection (103)
- Notch signaling pathway (93)
- Hedgehog signaling pathway (91)
- Metabolic pathways (91)
- Bladder cancer (87)
- RNA degradation (87)
- Cytosolic DNA-sensing pathway (83)
- Insulin signaling pathway (82)
- Non-small cell lung cancer (81)
- Antigen processing and presentation (78)
- Ubiquitin mediated proteolysis (77)
- RIG-I-like receptor signaling pathway (76)
- Neuroactive ligand-receptor interaction (71)
- NOD-like receptor signaling pathway (70)
- Circadian rhythm - mammal (69)
- Purine metabolism (68)
- Pyrimidine metabolism (68)
- Melanoma (64)
- RNA polymerase (61)
- Glioma (60)
- Oocyte meiosis (56)
- PPAR signaling pathway (54)
- Basal transcription factors (52)
- DNA replication (51)
- p53 signaling pathway (46)
- Primary immunodeficiency (42)
- Type II diabetes mellitus (41)
- Proteasome (37)
- Nucleotide excision repair (34)
- Base excision repair (32)
- Alzheimer's disease (30)
- Endocytosis (30)
- Natural killer cell mediated cytotoxicity (27)
- Cytokine-cytokine receptor interaction (23)
- Viral myocarditis (23)
- Axon guidance (22)
- Long-term potentiation (21)
- Allograft rejection (19)
- Dilated cardiomyopathy (19)
- Dorso-ventral axis formation (19)
- Graft-versus-host disease (19)
- Hypertrophic cardiomyopathy (HCM) (19)
- Type I diabetes mellitus (19)
- VEGF signaling pathway (16)
- Long-term depression (15)
- Systemic lupus erythematosus (15)
- Autoimmune thyroid disease (14)
- Cell adhesion molecules (CAMs) (14)
- mTOR signaling pathway (13)
- Fc gamma R-mediated phagocytosis (10)
- Regulation of actin cytoskeleton (10)
- Prion diseases (9)
- Calcium signaling pathway (8)
- Vascular smooth muscle contraction (6)
- Asthma (5)
- Cysteine and methionine metabolism (5)
- Hematopoietic cell lineage (5)
- Homologous recombination (5)
- Non-homologous end-joining (5)
- Glycolysis / Gluconeogenesis (4)
- Progesterone-mediated oocyte maturation (4)
- Spliceosome (4)
- Biosynthesis of unsaturated fatty acids (2)
- Glycerolipid metabolism (2)
- Glycine (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Lysine degradation (2)
- Mismatch repair (2)
- Ribosome (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- serine and threonine metabolism (2)
- SNARE interactions in vesicular transport (1)