Germany
Japan
United Kingdom
China
Antibodies
Download
USD 240.00
2 Weeks
CD34 mouse monoclonal antibody, clone QBEnd-10, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human, Primate |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
CD44 mouse monoclonal antibody, clone B-F24, Azide Free
| Applications | ELISA, FC, FN, IP |
| Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD19 mouse monoclonal antibody, clone HD37, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD38 mouse monoclonal antibody, clone T16, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Integrin alpha 3 (ITGA3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 500-550 of Human Integrin α3 |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
Rabbit Polyclonal Antibody against CD9 (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9. |
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Rabbit polyclonal anti-G-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 195 of human G-CSF |
Rabbit polyclonal anti-GM-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human GM-CSF protein. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit anti-IL-6R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL-6R |
Rabbit anti-IL1R2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1R2 |
Rabbit anti-CD19 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD19 |
Rabbit anti-MME Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MME |
Rabbit anti-CD22 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD22 |
Rabbit anti-CD36 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD36 |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
Rabbit Polyclonal Anti-Interleukin 4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4 |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit Polyclonal CD5 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
purified CD5 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3A9
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700465 |
purified CD5 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5D4
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700466 |
CD3E mouse monoclonal antibody, clone OKT3, Low Endotoxin
| Applications | FC, FN, IHC |
| Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD2 mouse monoclonal antibody, clone B-E2, Aff - Purified
| Applications | FC, FN, IF, IHC |
| Reactivities | Human |
CD38 mouse monoclonal antibody, clone T16, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
IL4R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 460-510 of Human IL-4Rα. |
Active filters
Category
- Antibodies
Pathways
- Hematopoietic cell lineage
Filter by
Target Symbol
- CD4 (232)
- CD5 (208)
- IL6 (144)
- CD44 (105)
- KIT (93)
- MS4A1 (90)
- CD19 (86)
- CD33 (84)
- CD8A (68)
- CD1C (67)
- CD34 (65)
- CD22 (64)
- CSF3 (60)
- TNF (60)
- CSF2 (59)
- CR2 (57)
- CD2 (54)
- FCER2 (48)
- CD14 (47)
- MME (45)
- FCGR1A (40)
- IL1A (38)
- CD3E (36)
- ITGB3 (35)
- ANPEP (34)
- CD38 (34)
- CD36 (32)
- KITLG (31)
- CSF1 (29)
- IL2RA (29)
- CSF2RA (26)
- IL3RA (25)
- CSF1R (23)
- IL1B (23)
- IL4 (23)
- ITGAM (21)
- EPOR (18)
- TFRC (18)
- CD7 (17)
- FLT3 (17)
- CD9 (15)
- IL3 (15)
- IL7 (14)
- CD59 (13)
- IL6R (13)
- ITGA6 (13)
- CR1 (11)
- EPO (11)
- ITGA4 (11)
- CD1A (10)
- CD55 (10)
- FLT3LG (10)
- GYPA (10)
- ITGA2 (9)
- ITGA5 (9)
- BMP2 (8)
- IL1R2 (8)
- IL5 (8)
- IL11 (7)
- ITGA3 (7)
- THPO (7)
- CD1D (6)
- CD3D (6)
- HLA-DRB5 (6)
- IL11RA (6)
- TPO (6)
- CD8B (5)
- CSF3R (5)
- DNTT (5)
- IL1R1 (5)
- IL4R (5)
- CD1B (4)
- CD37 (4)
- GP1BA (4)
- HLA-DRA (4)
- ITGA2B (4)
- CD1E (3)
- HLA-DRB3 (3)
- IL5RA (3)
- IL7R (3)
- GP1BB (2)
- GP9 (2)
- IL9R (2)
- ITGA1 (2)
- CD3G (1)
- GP5 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2456)
- Transmembrane (2166)
- ES Cell Differentiation/IPS (1064)
- Secreted Protein (711)
- Adult stem cells (633)
- Embryonic stem cells (333)
- Induced pluripotent stem cells (274)
- Cancer stem cells (212)
- Protein Kinase (133)
- Stem cell relevant signaling - DSL/Notch pathway (105)
- Protease (97)
- Stem cell - Pluripotency (93)
- Transcription Factors (60)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (8)