Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SDHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Goat Anti-SLC6A3 / DAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1. |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit polyclonal Parkin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin. |
Rabbit Polyclonal Anti-BSDC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Goat Polyclonal Antibody against PPID / CyP-40
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1. |
Rabbit polyclonal antibody to UBE2G2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 165 of UBE2G2 (Uniprot ID#P60604) |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
USD 424.00
2 Weeks
Rabbit Polyclonal Anti-ATP5F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST |
Rabbit Polyclonal Anti-NDUFV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG |
Mouse Monoclonal UCHL1 / PGP9.5 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit polyclonal anti-PINK1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 488 of mouse PINK1 |
Rabbit anti-UCHL1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UCHL1 |
Rabbit anti-SLC25A4 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC25A4 |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
COX7A1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 9-38 amino acids from the Central region of human COX7A1 |
Active filters
Category
- Antibodies
Pathways
- Parkinson's disease
Filter by
Target Symbol
- UCHL1 (151)
- TH (57)
- ATP5F1B (53)
- NDUFA7 (51)
- UBE2G2 (51)
- CASP3 (49)
- UBE2J1 (46)
- NDUFB10 (39)
- COX6A1 (36)
- SNCA (35)
- NDUFB9 (34)
- SDHB (33)
- CASP9 (26)
- UQCRC1 (22)
- NDUFA4L2 (21)
- CYCS (17)
- LRRK2 (16)
- NDUFB3 (15)
- NDUFS2 (14)
- PARK7 (13)
- SLC18A2 (13)
- APAF1 (12)
- COX6C (12)
- COX4I1 (11)
- PINK1 (9)
- UBB (9)
- PRKN (8)
- UBA7 (8)
- UQCRFS1 (8)
- ATP5F1C (7)
- NDUFA5 (7)
- UBE2L3 (7)
- VDAC2 (7)
- ATP5PO (6)
- COX6B2 (6)
- NDUFA2 (6)
- NDUFS1 (6)
- NDUFV2 (6)
- SLC6A3 (6)
- VDAC1 (6)
- COX6B1 (5)
- GPR37 (5)
- NDUFA8 (5)
- NDUFA9 (5)
- NDUFS8 (5)
- UBA1 (5)
- ATP5F1A (4)
- ATP5F1D (4)
- ATP5PF (4)
- COX5B (4)
- HTRA2 (4)
- NDUFA10 (4)
- NDUFA4 (4)
- NDUFS3 (4)
- NDUFS4 (4)
- PPID (4)
- SDHA (4)
- SLC18A1 (4)
- SLC25A4 (4)
- ATP5PB (3)
- ATP5PD (3)
- COX4I2 (3)
- COX5A (3)
- COX6A2 (3)
- COX7A1 (3)
- COX7A2 (3)
- COX7B (3)
- CYC1 (3)
- NDUFA3 (3)
- NDUFC2 (3)
- NDUFS5 (3)
- NDUFS6 (3)
- NDUFS7 (3)
- NDUFV1 (3)
- SLC25A31 (3)
- SLC25A6 (3)
- TRPC1 (3)
- UBE2L6 (3)
- VDAC3 (3)
- ATP5MC1 (2)
- ATP5MC2 (2)
- CASPASE 9 (2)
- COX7B2 (2)
- LCMT2 (2)
- MTND5 (2)
- NDUFA1 (2)
- NDUFA6 (2)
- NDUFAB1 (2)
- NDUFB5 (2)
- NDUFV3 (2)
- SDHD (2)
- UBE2J2 (2)
- UQCRB (2)
- UQCRC2 (2)
- ATP5E (1)
- ATP5MC3 (1)
- COX7A2L (1)
- COX7C (1)
- COX8A (1)
- MTATP6 (1)
Reactivities
- Human (1031)
- Mouse (614)
- Rat (592)
- Monkey (115)
- Dog (108)
- Bovine (31)
- Cow (13)
- Pig (11)
- Chimpanzee (9)
- Rhesus Monkey (8)
- Canine (5)
- Porcine (4)
- Rabbit (4)
- Xenopus (4)
- Chicken (3)
- Gerbil (3)
- Primate (3)
- X. tropicalis (3)
- Drosophila (2)
- Hamster (2)
- Sheep (2)
- Equine (1)
- Feline (1)
- Goat (1)
- Guinea Pig (1)
- Horse (1)
- Mammalian (1)