Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDK5 (Ab-15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T) |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Goat Anti-ERN1 / IRE1a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PNAHGKIKAMISD, from the internal region of the protein sequence according to NP_001424.3. |
Rabbit polyclonal anti-PLK3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PLK3. |
Rabbit polyclonal JAK2 (Tyr570) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JAK2 around the phosphorylation site of tyrosine 750 (G-D-YP-G-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-MAP4K3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human MAP4K3. |
Rabbit Polyclonal AurB (Thr232) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AurB around the phosphorylation site of Threonine 232 |
| Modifications | Phospho-specific |
Rabbit Polyclonal LIMK1/2 (Thr508/505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human LIMK1/2 around the phosphorylation site of Threonine 508/505 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Trk B (Tyr515) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B around the phosphorylation site of Tyrosine 515 (peptide seq 509-521aa: VIENPQY(p)FGITN) |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit anti-RIPK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RIPK2 |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Phospho-KDR-Y1175 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR |
| Modifications | Phospho-specific |
Rabbit Polyclonal IRE1 alpha [p Ser724] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit (Does not react with: Primate) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 724 of the human IRE1 alpha protein. [Swiss-Prot #O75460] |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Goat Polyclonal Anti-GNB2L1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GNB2L1 Antibody: Peptide with sequence NTLGVCKYTVQDESH, from the internal region of the protein sequence according to NP_006089.1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Clonalities
- Polyclonal
Families
- Protein Kinase
Filter by
Target Symbol
- AKT1 (47)
- EGFR (29)
- RPS6KB1 (19)
- ERBB2 (16)
- MAPK14 (16)
- RAF1 (16)
- IGF1R (15)
- JAK2 (15)
- PRKCD (15)
- MAP2K1 (14)
- CHUK (13)
- FGFR1 (13)
- GSK3B (13)
- MAPK1 (13)
- PAK1 (13)
- SRC (13)
- IKBKB (12)
- KDR (12)
- MET (12)
- PTK2 (12)
- SYK (12)
- BRAF (11)
- CHEK2 (11)
- GSK3A (11)
- LCK (11)
- LRRK2 (11)
- MAP3K7 (11)
- MAPK8 (11)
- NTRK2 (11)
- PDGFRB (11)
- ROCK2 (11)
- CDK2 (10)
- CSF1R (10)
- MAP2K6 (10)
- MAPK3 (10)
- PRKAA1 (10)
- PRKCA (10)
- PRKD1 (10)
- AKT2 (9)
- CDK1 (9)
- SGK1 (9)
- STK39 (9)
- ZAP70 (9)
- CDK5 (8)
- MAP2K4 (8)
- MTOR (8)
- PRKCB (8)
- RPS6KA1 (8)
- CAMK2A (7)
- CHEK1 (7)
- JAK1 (7)
- LIMK1 (7)
- PAK2 (7)
- PTK2B (7)
- TGFBR1 (7)
- ABL1 (6)
- CAMK2B (6)
- EPHA3 (6)
- INSR (6)
- LIMK2 (6)
- PDGFRA (6)
- PRKAA2 (6)
- PRKCQ (6)
- PRKCZ (6)
- AAK1 (5)
- AKT3 (5)
- BMPR2 (5)
- CAMK4 (5)
- COQ8B (5)
- DDR1 (5)
- EIF2AK3 (5)
- EPHA7 (5)
- ERN1 (5)
- FGFR2 (5)
- FGFR3 (5)
- FLT1 (5)
- GRK2 (5)
- KIT (5)
- MAP2K2 (5)
- MAP2K3 (5)
- MAP3K5 (5)
- MAP3K8 (5)
- MERTK (5)
- NTRK1 (5)
- PDPK1 (5)
- TRPM7 (5)
- ACVR1B (4)
- ACVR1C (4)
- BTK (4)
- CDK9 (4)
- CSK (4)
- CSNK1A1 (4)
- CSNK2A1 (4)
- EPHA4 (4)
- ERBB3 (4)
- ERBB4 (4)
- FYN (4)
- GRK5 (4)
- ILK (4)
- MAPK10 (4)
Applications
Antibody Hosts
Isotypes
Conjugates
Modifications
Pathways
- MAPK signaling pathway (446)
- Pathways in cancer (416)
- Focal adhesion (370)
- ErbB signaling pathway (354)
- Chemokine signaling pathway (306)
- Neurotrophin signaling pathway (294)
- Prostate cancer (289)
- T cell receptor signaling pathway (262)
- Insulin signaling pathway (253)
- Colorectal cancer (250)
- Pancreatic cancer (244)
- Fc epsilon RI signaling pathway (243)
- Glioma (241)
- GnRH signaling pathway (233)
- Melanoma (222)
- Progesterone-mediated oocyte maturation (221)
- Regulation of actin cytoskeleton (221)
- Fc gamma R-mediated phagocytosis (219)
- Toll-like receptor signaling pathway (212)
- Non-small cell lung cancer (208)
- VEGF signaling pathway (202)
- Endometrial cancer (200)
- Acute myeloid leukemia (196)
- Chronic myeloid leukemia (186)
- B cell receptor signaling pathway (184)
- Endocytosis (180)
- Renal cell carcinoma (175)
- Adherens junction (170)
- Gap junction (167)
- Axon guidance (163)
- mTOR signaling pathway (156)
- Adipocytokine signaling pathway (153)
- Natural killer cell mediated cytotoxicity (149)
- Vascular smooth muscle contraction (149)
- Epithelial cell signaling in Helicobacter pylori infection (145)
- Tight junction (135)
- Calcium signaling pathway (134)
- Long-term potentiation (130)
- Bladder cancer (128)
- Cytokine-cytokine receptor interaction (123)
- Melanogenesis (121)
- Oocyte meiosis (115)
- Long-term depression (114)
- Wnt signaling pathway (114)
- Small cell lung cancer (111)
- Apoptosis (109)
- NOD-like receptor signaling pathway (98)
- TGF-beta signaling pathway (95)
- Type II diabetes mellitus (91)
- Jak-STAT signaling pathway (89)
- RIG-I-like receptor signaling pathway (78)
- Leukocyte transendothelial migration (74)
- Cell cycle (73)
- Dorso-ventral axis formation (66)
- Thyroid cancer (62)
- Prion diseases (55)
- Alzheimer's disease (54)
- p53 signaling pathway (44)
- Amyotrophic lateral sclerosis (ALS) (39)
- Pathogenic Escherichia coli infection (35)
- Hedgehog signaling pathway (30)
- Olfactory transduction (30)
- Vibrio cholerae infection (30)
- Cytosolic DNA-sensing pathway (28)
- Primary immunodeficiency (25)
- Phosphatidylinositol signaling system (21)
- Regulation of autophagy (19)
- Hematopoietic cell lineage (16)
- Hypertrophic cardiomyopathy (HCM) (16)
- Parkinson's disease (15)
- Basal cell carcinoma (13)
- Viral myocarditis (11)
- Dilated cardiomyopathy (9)
- PPAR signaling pathway (9)
- Taste transduction (9)
- Ubiquitin mediated proteolysis (4)
- Purine metabolism (3)
- Circadian rhythm - mammal (2)
- Nucleotide excision repair (2)
- Basal transcription factors (1)