Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
CYP27A1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1. |
Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMACR |
USD 415.00
2 Weeks
Rabbit Polyclonal antibody to HSD17B4 (hydroxysteroid (17-beta) dehydrogenase 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 261 of HSD17B4 (Uniprot ID#P51659) |
Rabbit polyclonal anti-SLC27A5 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC27A5. |
CYP39A1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide from Human Cytochrome P450 39A1. |
AMACR (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 330-359 amino acids from the C-terminal region of human AMACR |
Rabbit Polyclonal Antibody against Cyp-46
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to residues between 200-250 of human Cyp46. |
Rabbit polyclonal Cytochrome P450 39A1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 39A1. |
Rabbit polyclonal SCP2 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2. |
Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP |
Rabbit Polyclonal Anti-SLC27A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC27A5 antibody: synthetic peptide directed towards the middle region of human SLC27A5. Synthetic peptide located within the following region: KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD |
Rabbit polyclonal antibody to HSD3a (aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 217 of HSD3a (Uniprot ID#P17516) |
USD 415.00
5 Days
Rabbit Polyclonal antibody to HSD17B4 (hydroxysteroid (17-beta) dehydrogenase 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 355 and 645 of HSD17B4 (Uniprot ID#P51659) |
Rabbit polyclonal Cytochrome P450 7B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
Rabbit polyclonal Cytochrome P450 27A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 27A1. |
Rabbit polyclonal anti-CYP39A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP39A1. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal Anti-CH25H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CH25H antibody is: synthetic peptide directed towards the C-terminal region of Human CH25H. Synthetic peptide located within the following region: VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH |
CYP7B1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Human |
Immunogen | Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1. |
USD 450.00
2 Weeks
Hydroxysteroid (17 beta) Dehydrogenase 4 (HSD17B4) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 340-370 amino acids from the Central region of human 17-beta-HSD4 / HSD17B4 |
Sterol carrier protein 2 (SCP2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 13-43 amino acids from the N-terminal region of Human SCP2 |
Goat Polyclonal Antibody against AKR1C4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DPKYQRVELNDGH-C, from the N Terminus of the protein sequence according to NP_001809.2. |
Rabbit Polyclonal Anti-CYP46A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM |
Rabbit Polyclonal Anti-CYP7B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE |
CYP7B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP7B1 |
ACOX2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ACOX2 |
AKR1C4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 10-39 amino acids from the N-terminal region of human AKR1C4. |
AKR1D1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 110-139 amino acids from the Central region of human AKR1D1 |
Goat Polyclonal Antibody against ACOX2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QWAQKSPTNTQENP, from the internal region (near the C Terminus) of the protein sequence according to NP_003491.1. |
Goat Polyclonal Antibody against ACOX2 (Near C-terminal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQSRLRPSDPEAK, from the internal region (near the C Terminus) of the protein sequence according to NP_003491.1. |
Rabbit polyclonal antibody to BAT (bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase))
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 139 and 415 of BAAT (Uniprot ID#Q14032) |
Rabbit anti-ACOX2 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ACOX2. |
Rabbit anti-AMACR Polyclonal Antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AMACR |
Goat Anti-AMACR Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLNSDKIIESN, from the C Terminus of the protein sequence according to NP_055139.4; NP_001161067.1 |
Goat Anti-AMACR (aa312-326) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RGSFITSEEQDVSPR, from the internal region of the protein sequence according to NP_055139.4; NP_001161067.1 |
Rabbit Polyclonal Anti-BAAT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BAAT antibody: synthetic peptide directed towards the N terminal of human BAAT. Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR |
Rabbit Polyclonal Anti-HSD3B7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD3B7 antibody: synthetic peptide directed towards the middle region of human HSD3B7. Synthetic peptide located within the following region: QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR |
Rabbit Polyclonal Anti-CYP27A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP27A1 antibody: synthetic peptide directed towards the middle region of human CYP27A1 |
Rabbit polyclonal Anti-SCP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SCP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SCP2. Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI |
Rabbit polyclonal Anti-SCP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCP2 antibody: synthetic peptide directed towards the middle region of human SCP2. Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA |
Rabbit Polyclonal Anti-CYP8B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Rabbit Polyclonal Anti-AKR1D1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AKR1D1 antibody: synthetic peptide directed towards the middle region of human AKR1D1. Synthetic peptide located within the following region: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL |
Rabbit anti AMACR Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ACOX2 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 2, branched chain |
Anti-ACOX2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 2, branched chain |
Anti-AKR1D1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-AKR1D1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-BAAT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BAAT |